You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
EGLN2
Egl nine homolog 2

Protein Summary
Description
Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF2A. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN2 is involved in regulating hypoxia tolerance and apoptosis in cardiac and skeletal muscle. Also regulates susceptibility to normoxic oxidative neuronal death. Links oxygen sensing to cell cycle and primary cilia formation by hydroxylating the c ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000303961
  • ENSP00000307080
  • ENSG00000269858
  • ENST00000406058
  • ENSP00000385253
  • ENST00000593726
  • ENSP00000469686

Symbol
  • EIT6
  • EIT6
  • PHD1
  • EIT-6
  • HPH-1
  • HPH-3
  • HIFPH1
  • HIF-PH1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.9
molecular function
0.86
transcription factor binding site profile
0.76
transcription factor
0.73
biological process
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 105.33   (req: < 5)
Gene RIFs: 50   (req: <= 3)
Antibodies: 397   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 105.33   (req: >= 5)
Gene RIFs: 50   (req: > 3)
Antibodies: 397   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 116
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
roxadustat
chemical structure image
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (151)
Cellular response to hypoxia (R-HSA-1234174)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cellular response to hypoxia
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Reactome
Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Name
Explore in Pharos
Explore in Source
Cellular response to hypoxia
Cellular responses to external stimuli
Cellular responses to stress
Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Gene Ontology Terms (15)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (91)
1 – 10 of 91
HIF1A
Tchem
Family: TF
Novelty: 0.00031917
Score: 0.995
Data Source: Reactome,STRINGDB
EPAS1
Tchem
Novelty: 0.00460751
Score: 0.994
Data Source: Reactome,STRINGDB
HIF3A
Tbio
Novelty: 0.00260684
Score: 0.975
Data Source: Reactome,STRINGDB
EGLN3
Tclin
Novelty: 0.00819671
Score: 0.931
Data Source: STRINGDB
OS9
Tbio
Novelty: 0.01598375
Score: 0.927
Data Source: STRINGDB
EGLN1
Tclin
Novelty: 0.00280193
Score: 0.907
Data Source: STRINGDB
VHL
Tchem
Family: Enzyme
Novelty: 0.00323188
Score: 0.87
Data Source: STRINGDB
UNK
Tbio
Novelty: 0.00279871
Score: 0.831
Data Source: STRINGDB
SIAH2
Tbio
Family: Enzyme
Novelty: 0.01729844
Score: 0.823
Data Source: STRINGDB
PRKCA
Tchem
Family: Kinase
Novelty: 0.00099987
Score: 0.8
Data Source: STRINGDB
Publication Statistics
PubMed Score  105.33

PubMed score by year
PubTator Score  96.07

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS
1-70
TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE
70-140
NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV
140-210
EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT
210-280
KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF
280-350
WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
350-407
MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQENQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT