Protein Summary
Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF2A. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN2 is involved in regulating hypoxia tolerance and apoptosis in cardiac and skeletal muscle. Also regulates susceptibility to normoxic oxidative neuronal death. Links oxygen sensing to cell cycle and primary cilia formation by hydroxylating the c ...more
- ENST00000303961
- ENSP00000307080
- ENSG00000269858
- ENST00000406058
- ENSP00000385253
- ENST00000593726
- ENSP00000469686
- EIT6
- EIT6
- PHD1
- EIT-6
- HPH-1
- HPH-3
- HIFPH1
- HIF-PH1
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
disease perturbation | 0.9 | ||
molecular function | 0.86 | ||
transcription factor binding site profile | 0.76 | ||
transcription factor | 0.73 | ||
biological process | 0.69 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 105.33 (req: < 5)
Gene RIFs: 50 (req: <= 3)
Antibodies: 397 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 105.33 (req: >= 5)
Gene RIFs: 50 (req: > 3)
Antibodies: 397 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 13
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 116
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
Active Ligands (116)
1 – 10 of 116
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (151)
Reactome (4)
KEGG (3)
PathwayCommons (3)
WikiPathways (141)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 4 of 4
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Cellular response to hypoxia | ||||
Reactome | Cellular responses to external stimuli | ||||
Reactome | Cellular responses to stress | ||||
Reactome | Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Cellular response to hypoxia | ||||
Cellular responses to external stimuli | ||||
Cellular responses to stress | ||||
Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha | ||||
Gene Ontology Terms (15)
Functions (5)
Components (2)
Processes (8)
Items per page:
10
1 – 5 of 5
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Electronic Annotation (IEA) | UniProtKB-KW | |||
Protein-Protein Interactions (91)
1 – 10 of 91
HIF1A
Family: TF
Novelty: 0.00031917
Score: 0.995
Data Source: Reactome,STRINGDB
EPAS1
Novelty: 0.00460751
Score: 0.994
Data Source: Reactome,STRINGDB
HIF3A
Novelty: 0.00260684
Score: 0.975
Data Source: Reactome,STRINGDB
EGLN3
Novelty: 0.00819671
Score: 0.931
Data Source: STRINGDB
OS9
Novelty: 0.01598375
Score: 0.927
Data Source: STRINGDB
EGLN1
Novelty: 0.00280193
Score: 0.907
Data Source: STRINGDB
VHL
Family: Enzyme
Novelty: 0.00323188
Score: 0.87
Data Source: STRINGDB
UNK
Novelty: 0.00279871
Score: 0.831
Data Source: STRINGDB
SIAH2
Family: Enzyme
Novelty: 0.01729844
Score: 0.823
Data Source: STRINGDB
PRKCA
Family: Kinase
Novelty: 0.00099987
Score: 0.8
Data Source: STRINGDB
Publication Statistics
PubMed Score 105.33
PubMed score by year
PubTator Score 96.07
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS
1-70
TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE
70-140
NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV
140-210
EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT
210-280
KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF
280-350
WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
350-407
MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQENQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
Find similar targets by: