You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
EHMT2
Histone-lysine N-methyltransferase EHMT2

Protein Summary
Description
Histone methyltransferase that specifically mono- and dimethylates 'Lys-9' of histone H3 (H3K9me1 and H3K9me2, respectively) in euchromatin. H3K9me represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. Also mediates monomethylation of 'Lys-56' of histone H3 (H3K56me1) in G1 phase, leading to promote interaction between histone H3 and PCNA and regulating DNA replication. Also weakly methylates 'Lys-27' of histone H3 (H3K27me). Also required for DNA methylation, the histone methyltransferase activity is not required for DNA methylation, suggesting that these 2 activities function independently. Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. May also methylate histone H1. In addition to the histone methyltransferase activity, also methylates non-histone proteins: mediates dimethylation of 'Lys-373' of p53/TP53. Also methylates CDYL, WIZ, ACIN1, DNMT1, HDAC1, ERCC6, KLF12 and ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000375530
  • ENSP00000364680
  • ENSG00000204371
  • ENST00000375537
  • ENSP00000364687
  • ENST00000383372
  • ENSP00000372863
  • ENSG00000206376
  • ENST00000383373
  • ENSP00000372864
  • ENST00000420336
  • ENSP00000396119
  • ENSG00000238134
  • ENST00000420874
  • ENSP00000411035
  • ENSG00000236759
  • ENST00000421926
  • ENSP00000416957
  • ENSG00000232045
  • ENST00000429506
  • ENSP00000406110
  • ENSG00000227333
  • ENST00000450075
  • ENSP00000392305
  • ENST00000450229
  • ENSP00000400838

Symbol
  • BAT8
  • C6orf30
  • G9A
  • KMT1C
  • NG36
  • G9A
  • BAT8
  • GAT8
  • NG36
  • KMT1C
  • C6orf30
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
molecular function
0.81
disease perturbation
0.74
drug perturbation
0.71
disease
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 358.01   (req: < 5)
Gene RIFs: 103   (req: <= 3)
Antibodies: 333   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 358.01   (req: >= 5)
Gene RIFs: 103   (req: > 3)
Antibodies: 333   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 54
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (54)
1 – 10 of 54
CHEMBL418052
chemical structure image
CHEMBL1231795
chemical structure image
CHEMBL569864
chemical structure image
CHEMBL576781
chemical structure image
CHEMBL2441082
chemical structure image
CHEMBL1829304
chemical structure image
CHEMBL1829305
chemical structure image
CHEMBL3109630
chemical structure image
CHEMBL1829298,CHEMBL1829296
chemical structure image
CHEMBL1232453
chemical structure image
Protein Data Bank (16)
1 – 5 of 16
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (26)
Cellular Senescence (R-HSA-2559583)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 20
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cellular Senescence
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Reactome
Chromatin modifying enzymes
Reactome
Chromatin organization
Name
Explore in Pharos
Explore in Source
Cellular Senescence
Cellular responses to external stimuli
Cellular responses to stress
Chromatin modifying enzymes
Chromatin organization
Gene Ontology Terms (20)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (326)
1 – 10 of 326
XAGE2
Tbio
Novelty: 0.08465433
p_int: 0.999999554
p_ni: 4.23e-7
p_wrong: 2.3e-8
Score: 0.189
Data Source: BioPlex,STRINGDB
XAGE3
Tdark
Novelty: 0.26627219
p_int: 0.999999043
p_ni: 9.47e-7
p_wrong: 9e-9
Score: 0.183
Data Source: BioPlex,STRINGDB
ZNF462
Tbio
Novelty: 0.18629408
p_int: 0.999985685
p_ni: 0.000014314
p_wrong: 2e-9
Score: 0.579
Data Source: BioPlex,STRINGDB
MIER2
Tbio
Novelty: 1.42857143
p_int: 0.999887522
p_ni: 0.000112477
p_wrong: 1e-9
Score: 0.251
Data Source: BioPlex,STRINGDB
RARRES1
Tbio
Family: Enzyme
Novelty: 0.03698309
p_int: 0.999822313
p_ni: 0.000177687
Data Source: BioPlex
L3MBTL1
Tchem
Family: TF; Epigenetic
Novelty: 0.00347268
p_int: 0.999421648
p_ni: 0.000578351
p_wrong: 1e-9
Score: 0.534
Data Source: BioPlex,STRINGDB
CDY2A
Tdark
Family: Epigenetic
p_int: 0.993414304
p_ni: 0.006585667
p_wrong: 2.9e-8
Data Source: BioPlex
ZNF223
Tdark
Family: TF
Novelty: 1
p_int: 0.992019161
p_ni: 0.007978831
p_wrong: 0.000002009
Score: 0.241
Data Source: BioPlex,STRINGDB
ZBTB46
Tbio
Family: TF
Novelty: 0.06454587
p_int: 0.984154005
p_ni: 0.015845984
p_wrong: 1.1e-8
Score: 0.241
Data Source: BioPlex,STRINGDB
COPRS
Tbio
Novelty: 0.06881767
p_int: 0.984103725
p_ni: 0.015896092
p_wrong: 1.83e-7
Data Source: BioPlex
Publication Statistics
PubMed Score  358.01

PubMed score by year
PubTator Score  174.48

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAAAGAAAAAAAEGEAPAEMGALLLEKETRGATERVHGSLGDTPRSEETLPKATPDSLEPAGPSSPASV
1-70
TVTVGDEGADTPVGATPLIGDESENLEGDGDLRGGRILLGHATKSFPSSPSKGGSCPSRAKMSMTGAGKS
70-140
PPSVQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNGQPPVPEKRPPEIQHFRM
140-210
SDDVHSLGKVTSDLAKRRKLNSGGGLSEELGSARRSGEVTLTKGDPGSLEEWETVVGDDFSLYYDSYSVD
210-280
ERVDSDSKSEVEALTEQLSEEEEEEEEEEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDS
280-350
PWVKPSRKRRKREPPRAKEPRGVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGF
350-420
EELPLCSCRMEAPKIDRISERAGHKCMATESVDGELSGCNAAILKRETMRPSSRVALMVLCETHRARMVK
420-490
HHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVTIPRGDGVTPPAGT
490-560
AAPAPPPLSQDVPGRADTSQPSARMRGHGEPRRPPCDPLADTIDSSGPSLTLPNGGCLSAVGLPLGPGRE
560-630
ALEKALVIQESERRKKLRFHPRQLYLSVKQGELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEI
630-700
CHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLL
700-770
LSTGQVDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNA
770-840
RCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKLRLG
840-910
VGNRAIRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDC
910-980
SSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIKVRLQLYRTAKMGW
980-1050
GVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNII
1050-1120
PVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLA
1120-1190
RLDPHPELLPELGSLPPVNT
1190-1210
MAAAAGAAAAAAAEGEAPAEMGALLLEKETRGATERVHGSLGDTPRSEETLPKATPDSLEPAGPSSPASVTVTVGDEGADTPVGATPLIGDESENLEGDGDLRGGRILLGHATKSFPSSPSKGGSCPSRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNGQPPVPEKRPPEIQHFRMSDDVHSLGKVTSDLAKRRKLNSGGGLSEELGSARRSGEVTLTKGDPGSLEEWETVVGDDFSLYYDSYSVDERVDSDSKSEVEALTEQLSEEEEEEEEEEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRAKEPRGVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGFEELPLCSCRMEAPKIDRISERAGHKCMATESVDGELSGCNAAILKRETMRPSSRVALMVLCETHRARMVKHHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVTIPRGDGVTPPAGTAAPAPPPLSQDVPGRADTSQPSARMRGHGEPRRPPCDPLADTIDSSGPSLTLPNGGCLSAVGLPLGPGREALEKALVIQESERRKKLRFHPRQLYLSVKQGELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKLRLGVGNRAIRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLPELGSLPPVNT