You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SHD
SH2 domain-containing adapter protein D

Protein Summary
Description
May function as an adapter protein.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000543264
  • ENSP00000446058
  • ENSG00000105251
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.71
cellular component
0.64
tissue
0.55
gene perturbation
0.5
disease
0.48


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 46.08   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 76   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 46.08   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 76   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (26)
1 – 10 of 26
CWC25
Tdark
Novelty: 0.16280202
Score: 0.841
Data Source: STRINGDB
SLCO1A2
Tchem
Family: Transporter
Novelty: 0.00265661
Score: 0.841
Data Source: STRINGDB
LIX1
Tbio
Novelty: 0.00473632
Score: 0.84
Data Source: STRINGDB
C1orf109
Tdark
Novelty: 1.81818182
Score: 0.84
Data Source: STRINGDB
ACOT11
Tbio
Family: Enzyme
Novelty: 0.00262976
Score: 0.839
Data Source: STRINGDB
RUBCNL
Tbio
Novelty: 0.20075448
Score: 0.839
Data Source: STRINGDB
CD300LG
Tbio
Novelty: 0.12059672
Score: 0.822
Data Source: STRINGDB
DHRS2
Tbio
Family: Enzyme
Novelty: 0.00319535
Score: 0.811
Data Source: STRINGDB
UGT3A1
Tdark
Family: Enzyme
Novelty: 0.43134175
Score: 0.679
Data Source: STRINGDB
UGT3A2
Tbio
Family: Enzyme
Novelty: 1.37837838
Score: 0.679
Data Source: STRINGDB
Publication Statistics
PubMed Score  46.08

PubMed score by year
PubTator Score  5.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAKWLRDYLSFGGRRPPPQPPTPDYTESDILRAYRAQKNLDFEDPYEDAESRLEPDPAGPGDSKNPGDAK
1-70
YGSPKHRLIKVEAADMARAKALLGGPGEELEADTEYLDPFDAQPHPAPPDDGYMEPYDAQWVMSELPGRG
70-140
VQLYDTPYEEQDPETADGPPSGQKPRQSRMPQEDERPADEYDQPWEWKKDHISRAFAVQFDSPEWERTPG
140-210
SAKELRRPPPRSPQPAERVDPALPLEKQPWFHGPLNRADAESLLSLCKEGSYLVRLSETNPQDCSLSLRS
210-280
SQGFLHLKFARTRENQVVLGQHSGPFPSVPELVLHYSSRPLPVQGAEHLALLYPVVTQTP
280-340
MAKWLRDYLSFGGRRPPPQPPTPDYTESDILRAYRAQKNLDFEDPYEDAESRLEPDPAGPGDSKNPGDAKYGSPKHRLIKVEAADMARAKALLGGPGEELEADTEYLDPFDAQPHPAPPDDGYMEPYDAQWVMSELPGRGVQLYDTPYEEQDPETADGPPSGQKPRQSRMPQEDERPADEYDQPWEWKKDHISRAFAVQFDSPEWERTPGSAKELRRPPPRSPQPAERVDPALPLEKQPWFHGPLNRADAESLLSLCKEGSYLVRLSETNPQDCSLSLRSSQGFLHLKFARTRENQVVLGQHSGPFPSVPELVLHYSSRPLPVQGAEHLALLYPVVTQTP