You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RAX2
Retina and anterior neural fold homeobox protein 2

Protein Summary
Description
May be involved in modulating the expression of photoreceptor specific genes. Binds to the Ret-1 and Bat-1 element within the rhodopsin promoter. This gene encodes a homeodomain-containing protein that plays a role in eye development. Mutation of this gene causes age-related macular degeneration type 6, an eye disorder resulting in accumulations of protein and lipid beneath the retinal pigment epithelium and within the Bruch's membrane. Defects in this gene can also cause cone-rod dystrophy type 11, a disease characterized by the initial degeneration of cone photoreceptor cells and resulting in loss of color vision and visual acuity, followed by the degeneration of rod photoreceptor cells, which progresses to night blindness and the loss of peripheral vision. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000555633
  • ENSP00000450456
  • ENSG00000173976
  • ENST00000555978
  • ENSP00000450687

Symbol
  • QRX
  • RAXL1
  • QRX
  • ARMD6
  • RAXL1
  • CORD11
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.58
cell line
0.57
microRNA
0.57
phenotype
0.51
disease
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.08   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 44   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.08   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 44   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (50)
1 – 10 of 50
CRX
Tbio
Family: TF
Novelty: 0.0033831
Score: 0.882
Data Source: STRINGDB
LEUTX
Tdark
Family: TF
Novelty: 0.38834951
Score: 0.811
Data Source: STRINGDB
DPRX
Tdark
Family: TF
Novelty: 0.16973126
Score: 0.749
Data Source: STRINGDB
PLAC9
Tdark
Novelty: 0.37260274
Score: 0.595
Data Source: STRINGDB
PITPNM3
Tbio
Novelty: 0.02900119
Score: 0.576
Data Source: STRINGDB
FIZ1
Tdark
Family: TF
Novelty: 0.4990099
Score: 0.566
Data Source: STRINGDB
AKTIP
Tbio
Novelty: 0.00129346
Score: 0.557
Data Source: STRINGDB
GUCA1A
Tbio
Family: Enzyme
Novelty: 0.01070141
Score: 0.549
Data Source: STRINGDB
C8orf37
Tbio
Novelty: 0.00717703
Score: 0.549
Data Source: STRINGDB
TPRX1
Tdark
Novelty: 0.16064257
Score: 0.548
Data Source: STRINGDB
Publication Statistics
PubMed Score  14.08

PubMed score by year
PubTator Score  7.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVR
1-70
VQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGP
70-140
GLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA
140-184
MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA