You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CRELD1
Cysteine-rich with EGF-like domain protein 1

Protein Classes
Protein Summary
Description
This gene encodes a member of a subfamily of epidermal growth factor-related proteins. The encoded protein is characterized by a cysteine-rich with epidermal growth factor-like domain. This protein may function as a cell adhesion molecule. Mutations in this gene are the cause of atrioventricular septal defect. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Apr 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000326434
  • ENSP00000321856
  • ENSG00000163703
  • ENST00000383811
  • ENSP00000373322
  • ENST00000397170
  • ENSP00000380355
  • ENST00000452070
  • ENSP00000393643

Symbol
  • CIRRIN
  • AVSD2
  • CIRRIN
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.99
histone modification site profile
0.91
transcription factor binding site profile
0.76
tissue
0.56
cell type or tissue
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.81   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 91   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.81   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 91   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (51)
1 – 10 of 51
P2RY12
Tclin
Family: GPCR
Novelty: 0.00057146
p_int: 0.9985387
p_ni: 0.001460822
p_wrong: 4.78e-7
Data Source: BioPlex
CD27
Tbio
Novelty: 0.00109406
p_int: 0.986981083
p_ni: 0.012850694
p_wrong: 0.000168223
Score: 0.157
Data Source: BioPlex,STRINGDB
HTR3A
Tclin
Family: IC
Novelty: 0.00035394
p_int: 0.98160475
p_ni: 0.018216355
p_wrong: 0.000178895
Data Source: BioPlex
CES2
Tchem
Family: Enzyme
Novelty: 0.0023511
p_int: 0.969615371
p_ni: 0.030384627
p_wrong: 2e-9
Data Source: BioPlex
ANKRD9
Tdark
Novelty: 0.4990099
p_int: 0.967477208
p_ni: 0.032522788
p_wrong: 4e-9
Data Source: BioPlex
CYP26B1
Tchem
Novelty: 0.01159641
p_int: 0.946470026
p_ni: 0.053529888
p_wrong: 8.6e-8
Data Source: BioPlex
ADGRG5
Tdark
Family: GPCR
Novelty: 0.38877844
p_int: 0.901624728
p_ni: 0.011710517
p_wrong: 0.086664755
Data Source: BioPlex
HIBADH
Tbio
Family: Enzyme
Novelty: 0.05644529
p_int: 0.874591879
p_ni: 0.125408105
p_wrong: 1.6e-8
Data Source: BioPlex
FZD10
Tbio
Family: GPCR
Novelty: 0.03473251
p_int: 0.768085865
p_ni: 0.012479137
p_wrong: 0.219434997
Data Source: BioPlex
GDF2
Tbio
Novelty: 0.00530492
Score: 0.648
Data Source: STRINGDB
Publication Statistics
PubMed Score  17.81

PubMed score by year
PubTator Score  17.98

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPWPPKGLVPAMLWGLSLFLNLPGPIWLQPSPPPQSSPPPQPHPCHTCRGLVDSFNKGLERTIRDNFGG
1-70
GNTAWEEENLSKYKDSETRLVEVLEGVCSKSDFECHRLLELSEELVESWWFHKQQEAPDLFQWLCSDSLK
70-140
LCCPAGTFGPSCLPCPGGTERPCGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHLV
140-210
CSACFGPCARCSGPEESNCLQCKKGWALHHLKCVDIDECGTEGANCGADQFCVNTEGSYECRDCAKACLG
210-280
CMGAGPGRCKKCSPGYQQVGSKCLDVDECETEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPE
280-350
SAGFFSEMTEDELVVLQQMFFGIIICALATLAAKGDLVFTAIFIGAVAAMTGYWLSERSDRVLEGFIKGR
350-420
MAPWPPKGLVPAMLWGLSLFLNLPGPIWLQPSPPPQSSPPPQPHPCHTCRGLVDSFNKGLERTIRDNFGGGNTAWEEENLSKYKDSETRLVEVLEGVCSKSDFECHRLLELSEELVESWWFHKQQEAPDLFQWLCSDSLKLCCPAGTFGPSCLPCPGGTERPCGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHLVCSACFGPCARCSGPEESNCLQCKKGWALHHLKCVDIDECGTEGANCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLDVDECETEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTEDELVVLQQMFFGIIICALATLAAKGDLVFTAIFIGAVAAMTGYWLSERSDRVLEGFIKGR