You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PAGE5
P antigen family member 5

Protein Summary
Description
This gene is a member of family of proteins that are expressed in a variety of tumors and in some fetal and reproductive tissues. The encoded protein may protect cells from programmed cell death. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found. [provided by RefSeq, Jan 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000289619
  • ENSP00000289619
  • ENSG00000158639
  • ENST00000374955
  • ENSP00000364093

Symbol
  • GAGEE1
  • CT16
  • CT16.1
  • CT16.2
  • GAGEE1
  • PAGE-5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.46
tissue sample
0.44
disease
0.43
biological term
0.33
tissue
0.33


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 42.46   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 67   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 42.46   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 67   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (33)
1 – 10 of 33
PRSS50
Tbio
Family: Enzyme
Novelty: 0.01430737
Score: 0.79
Data Source: STRINGDB
SAGE1
Tdark
Novelty: 0.00093726
Score: 0.745
Data Source: STRINGDB
MAGEC2
Tbio
Novelty: 0.00896194
Score: 0.675
Data Source: STRINGDB
SPA17
Tbio
Novelty: 0.03111443
Score: 0.67
Data Source: STRINGDB
LIPI
Tbio
Family: Enzyme
Novelty: 0.01006605
Score: 0.66
Data Source: STRINGDB
ADAM2
Tbio
Family: Enzyme
Novelty: 0.00672579
Score: 0.656
Data Source: STRINGDB
NREP
Tbio
Novelty: 0.03925581
Score: 0.654
Data Source: STRINGDB
PER2
Tchem
Novelty: 0.0020454
Score: 0.583
Data Source: STRINGDB
XAGE1A
Tbio
Novelty: 0.04709514
Score: 0.575
Data Source: STRINGDB
ARNTL
Tbio
Family: TF
Novelty: 0.00130179
Score: 0.567
Data Source: STRINGDB
Publication Statistics
PubMed Score  42.46

PubMed score by year
PubTator Score  22.02

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEEPPTDNQGIAP
1-70
SGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPTKVLEAGEGQL
70-130
MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEEPPTDNQGIAPSGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPTKVLEAGEGQL