You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ZDHHC12
Probable palmitoyltransferase ZDHHC12

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000372663
  • ENSP00000361748
  • ENSG00000160446

Symbol
  • ZNF400
  • ZNF400
  • DHHC-12
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.9
tissue sample
0.59
transcription factor binding site profile
0.58
transcription factor perturbation
0.54
molecular function
0.53


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.61   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 58   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.61   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 58   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (10)
1 – 10 of 10
ZNF454
Tdark
Family: TF
Novelty: 7
Score: 0.498
Data Source: STRINGDB
GPHN
Tbio
Novelty: 0.00317968
Score: 0.481
Data Source: STRINGDB
TMEM179
Tdark
Score: 0.478
Data Source: STRINGDB
ZNF540
Tbio
Family: TF
Novelty: 1.4251497
Score: 0.478
Data Source: STRINGDB
TMEM134
Tdark
Novelty: 0.4
Score: 0.473
Data Source: STRINGDB
KIAA1551
Tdark
Novelty: 0.27415144
Score: 0.471
Data Source: STRINGDB
NRIP2
Tdark
Novelty: 2
Score: 0.467
Data Source: STRINGDB
ZNF419
Tdark
Family: TF
Novelty: 1.16326531
Score: 0.456
Data Source: STRINGDB
SERINC2
Tbio
Novelty: 0.11338583
Score: 0.445
Data Source: STRINGDB
REEP6
Tbio
Novelty: 0.17493781
Score: 0.409
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.61

PubMed score by year
PubTator Score  0.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPWALLSPGVLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELLLPLTFLLLVLGSLLLYLAVSLMDPG
1-70
YVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHP
70-140
LFVVYLALQLVVLLWGLYLAWSGLRFFQPWGQWLRSSGLLFATFLLLSLFSLVASLLLVSHLYLVASNTT
140-210
TWEFISSHRIAYLRQRPSNPFDRGLTRNLAHFFCGWPSGSWETLWAEEEEEGSSPAV
210-267
MAPWALLSPGVLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELLLPLTFLLLVLGSLLLYLAVSLMDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVVYLALQLVVLLWGLYLAWSGLRFFQPWGQWLRSSGLLFATFLLLSLFSLVASLLLVSHLYLVASNTTTWEFISSHRIAYLRQRPSNPFDRGLTRNLAHFFCGWPSGSWETLWAEEEEEGSSPAV