You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SCARF2
Scavenger receptor class F member 2

Protein Classes
Protein Summary
Description
Probable adhesion protein, which mediates homophilic and heterophilic interactions. In contrast to SCARF1, it poorly mediates the binding and degradation of acetylated low density lipoprotein (Ac-LDL) (By similarity). The protein encoded by this gene is similar to SCARF1/SREC-I, a scavenger receptor protein that mediates the binding and degradation of acetylated low density lipoprotein (Ac-LDL). This protein has only little activity of internalizing modified low density lipoproteins (LDL), but it can interact with SCARF1 through its extracellular domain. The association of this protein with SCARF1 is suppressed by the presence of scavenger ligands. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000622235
  • ENSP00000477564
  • ENSG00000244486

Symbol
  • SREC2
  • SREPCR
  • NSR1
  • SREC2
  • VDEGS
  • SREC-II
  • SRECRP-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.84
hub protein
0.75
transcription factor
0.59
protein domain
0.58
histone modification site profile
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.49   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 99   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.49   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 99   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
22q11.2 Deletion Syndrome
WikiPathways
22q11.2 Deletion Syndrome
WikiPathways
22q11.2 Deletion Syndrome
WikiPathways
22q11.2 Deletion Syndrome
Name
Explore in Pharos
Explore in Source
22q11.2 Deletion Syndrome
22q11.2 Deletion Syndrome
22q11.2 Deletion Syndrome
22q11.2 Deletion Syndrome
Gene Ontology Terms (3)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (22)
1 – 10 of 22
KLHL22
Tbio
Novelty: 0.50704225
p_int: 1
Score: 0.653
Data Source: BioPlex,STRINGDB
SLC39A5
Tbio
Family: Transporter
Novelty: 0.06778122
p_int: 0.999763217
p_ni: 0.000236307
p_wrong: 4.76e-7
Score: 0.183
Data Source: BioPlex,STRINGDB
SFTPC
Tbio
Novelty: 0.00174879
p_int: 0.999653495
p_ni: 0.000346505
Score: 0.219
Data Source: BioPlex,STRINGDB
SPINT2
Tbio
Family: Enzyme
Novelty: 0.00575409
p_int: 0.999041173
p_ni: 0.000881916
p_wrong: 0.000076911
Data Source: BioPlex
ITGB2
Tclin
Novelty: 0.00237551
p_int: 0.998307812
p_ni: 0.001669338
p_wrong: 0.00002285
Data Source: BioPlex
APELA
Tbio
Novelty: 0.00033318
Score: 0.914
Data Source: STRINGDB
CALML5
Tbio
Novelty: 0.03997456
Score: 0.901
Data Source: STRINGDB
FBN2
Tbio
Novelty: 0.00189782
Score: 0.675
Data Source: STRINGDB
ZNF74
Tbio
Family: TF
Novelty: 0.14162077
Score: 0.638
Data Source: STRINGDB
F11
Tchem
Family: Enzyme
Novelty: 0.00186114
Score: 0.625
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.49

PubMed score by year
PubTator Score  13.49

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEGAGPRGAGPARRRGAGGPPSPLLPSLLLLLLLWMLPDTVAPQELNPRGRNVCRAPGSQVPTCCAGWRQ
1-70
QGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQFWGPDCKELCSCHPHGQCEDVTGQ
70-140
CTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWWGAQCASACYCSATSRCDPQTGACLCHAGWWGRS
140-210
CNNQCACNSSPCEQQSGRCQCRERTFGARCDRYCQCFRGRCHPVDGTCACEPGYRGKYCREPCPAGFYGL
210-280
GCRRRCGQCKGQQPCTVAEGRCLTCEPGWNGTKCDQPCATGFYGEGCSHRCPPCRDGHACNHVTGKCTRC
280-350
NAGWIGDRCETKCSNGTYGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNVTCPPGLHGADCAQACS
350-420
CHEDTCDPVTGACHLETNQRKGVMGAGALLVLLVCLLLSLLGCCCACRGKDPTRRPRPRRELSLGRKKAP
420-490
HRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPSGLEQPSPSWSSRASFSSFDTTDE
490-560
GPVYCVPHEEAPAESRDPEVPTVPAEAPAPSPVPLTTPASAEEAIPLPASSDSERSASSVEGPGGALYAR
560-630
VARREARPARARGEIGGLSLSPSPERRKPPPPDPATKPKVSWIHGKHSAAAAGRAPSPPPPGSEAAPSPS
630-700
KRKRTPSDKSAHTVEHGSPRTRDPTPRPPGLPEEATALAAPSPPRARARAAPRPLGAHGRRRSPAKRAEA
700-770
ASMLAADVRGKTRSLGRAEVALGAQGPREKPAPPQKAKRSVPPASPARAPPATETPGPEKAATDLPAPET
770-840
PRKKTPIQKPPRKKSREAAGELGRAGAPTL
840-870
MEGAGPRGAGPARRRGAGGPPSPLLPSLLLLLLLWMLPDTVAPQELNPRGRNVCRAPGSQVPTCCAGWRQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQFWGPDCKELCSCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWWGAQCASACYCSATSRCDPQTGACLCHAGWWGRSCNNQCACNSSPCEQQSGRCQCRERTFGARCDRYCQCFRGRCHPVDGTCACEPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPCTVAEGRCLTCEPGWNGTKCDQPCATGFYGEGCSHRCPPCRDGHACNHVTGKCTRCNAGWIGDRCETKCSNGTYGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNVTCPPGLHGADCAQACSCHEDTCDPVTGACHLETNQRKGVMGAGALLVLLVCLLLSLLGCCCACRGKDPTRRPRPRRELSLGRKKAPHRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPSGLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAPAESRDPEVPTVPAEAPAPSPVPLTTPASAEEAIPLPASSDSERSASSVEGPGGALYARVARREARPARARGEIGGLSLSPSPERRKPPPPDPATKPKVSWIHGKHSAAAAGRAPSPPPPGSEAAPSPSKRKRTPSDKSAHTVEHGSPRTRDPTPRPPGLPEEATALAAPSPPRARARAAPRPLGAHGRRRSPAKRAEAASMLAADVRGKTRSLGRAEVALGAQGPREKPAPPQKAKRSVPPASPARAPPATETPGPEKAATDLPAPETPRKKTPIQKPPRKKSREAAGELGRAGAPTL