You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ARSG
Arylsulfatase G

Protein Classes
Protein Summary
Description
Displays arylsulfatase activity at acidic pH with pseudosubstrates, such as p-nitrocatechol sulfate and also, but with lower activity, p-nitrophenyl sulfate and 4-methylumbelliferyl sulfate. The protein encoded by this gene belongs to the sulfatase enzyme family. Sulfatases hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules. This protein displays arylsulfatase activity at acidic pH, as is typical of lysosomal sulfatases, and has been shown to localize in the lysosomes. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000448504
  • ENSP00000407193
  • ENSG00000141337
  • ENST00000621439
  • ENSP00000480910

Symbol
  • KIAA1001
  • USH4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor
0.65
tissue sample
0.64
trait
0.61
protein domain
0.58
cellular component
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.68   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 147   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.68   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 147   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
Gamma carboxylation, hypusine formation and arylsulfatase activation (R-HSA-163841)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gamma carboxylation, hypusine formation and arylsulfatase activation
Reactome
Glycosphingolipid metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Gamma carboxylation, hypusine formation and arylsulfatase activation
Glycosphingolipid metabolism
Metabolism
Metabolism of lipids
Metabolism of proteins
Gene Ontology Terms (7)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (60)
1 – 10 of 60
SUMF1
Tbio
Family: Enzyme
Novelty: 0.01184153
p_int: 0.999694438
p_ni: 0.000305561
p_wrong: 1e-9
Score: 0.976
Data Source: BioPlex,STRINGDB
YDJC
Tdark
Family: Enzyme
Novelty: 0.41297935
p_int: 0.999232978
p_ni: 0.000057457
p_wrong: 0.000709565
Score: 0.187
Data Source: BioPlex,STRINGDB
GSK3A
Tclin
Family: Kinase
Novelty: 0.01538406
p_int: 0.997910093
p_ni: 0.000487303
p_wrong: 0.001602604
Score: 0.183
Data Source: BioPlex,STRINGDB
TMEM214
Tdark
Novelty: 1.5
p_int: 0.988771852
p_ni: 0.011228148
Data Source: BioPlex
PTPRK
Tbio
Family: Enzyme
Novelty: 0.03472453
p_int: 0.983850479
p_ni: 0.016125288
p_wrong: 0.000024233
Score: 0.243
Data Source: BioPlex,STRINGDB
MESD
Tbio
Novelty: 0.04043386
p_int: 0.977610868
p_ni: 0.022389084
p_wrong: 4.8e-8
Score: 0.173
Data Source: BioPlex,STRINGDB
PSCA
Tbio
Novelty: 0.00370639
p_int: 0.969629946
p_ni: 0.030366885
p_wrong: 0.000003169
Data Source: BioPlex
CTAGE5
Tbio
Novelty: 0.06289332
p_int: 0.966319572
p_ni: 0.033670182
p_wrong: 0.000010246
Data Source: BioPlex
TUBA4A
Tchem
Novelty: 0.02626744
p_int: 0.953537838
p_ni: 0.046462162
Score: 0.15
Data Source: BioPlex,STRINGDB
DPH1
Tbio
Novelty: 0.02897945
p_int: 0.945293379
p_ni: 0.054706621
Data Source: BioPlex
Publication Statistics
PubMed Score  13.68

PubMed score by year
PubTator Score  15.08

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASE
1-70
GMRFVDFHAAASTCSPSRASLLTGRLGLRNGVTRNFAVTSVGGLPLNETTLAEVLQQAGYVTGIIGKWHL
70-140
GHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIV
140-210
EQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPLPVTQLPAAPRGRSLYGAGLWEMDSLV
210-280
GQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQGGSPAKQTTWEGGHRVPALAYWP
280-350
GRVPVNVTSTALLSVLDIFPTVVALAQASLPQGRRFDGVDVSEVLFGRSQPGHRVLFHPNSGAAGEFGAL
350-420
QTVRLERYKAFYITGGARACDGSTGPELQHKFPLIFNLEDDTAEAVPLERGGAEYQAVLPEVRKVLADVL
420-490
QDIANDNISSADYTQDPSVTPCCNPYQIACRCQAA
490-525
MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASEGMRFVDFHAAASTCSPSRASLLTGRLGLRNGVTRNFAVTSVGGLPLNETTLAEVLQQAGYVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPLPVTQLPAAPRGRSLYGAGLWEMDSLVGQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQGGSPAKQTTWEGGHRVPALAYWPGRVPVNVTSTALLSVLDIFPTVVALAQASLPQGRRFDGVDVSEVLFGRSQPGHRVLFHPNSGAAGEFGALQTVRLERYKAFYITGGARACDGSTGPELQHKFPLIFNLEDDTAEAVPLERGGAEYQAVLPEVRKVLADVLQDIANDNISSADYTQDPSVTPCCNPYQIACRCQAA