You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SPACA9
Sperm acrosome-associated protein 9

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000350499
  • ENSP00000298546
  • ENSG00000165698
  • ENST00000356311
  • ENSP00000348659
  • ENST00000372136
  • ENSP00000361209

Symbol
  • C9orf9
  • Mast
  • C9orf9
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.27   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 51   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.27   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 51   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (7)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (28)
1 – 10 of 28
RIOX2
Tbio
Family: Epigenetic
Novelty: 0.03616637
p_int: 0.884579758
p_ni: 0.115420242
Score: 0.282
Data Source: BioPlex,STRINGDB
MUCL1
Tbio
Novelty: 0.02014811
p_int: 0.832942602
p_ni: 0.166991255
p_wrong: 0.000066143
Score: 0.303
Data Source: BioPlex,STRINGDB
SPACA7
Tdark
Novelty: 0.5
Score: 0.654
Data Source: STRINGDB
TMBIM4
Tbio
Novelty: 0.01198169
Score: 0.634
Data Source: STRINGDB
EIF2S2
Tbio
Novelty: 0.017562
Score: 0.598
Data Source: STRINGDB
TMEM31
Tdark
Novelty: 0.66666667
Score: 0.57
Data Source: STRINGDB
AK8
Tbio
Family: Kinase
Novelty: 0.10878907
Score: 0.546
Data Source: STRINGDB
EIF2S1
Tbio
Novelty: 0.00157698
Score: 0.546
Data Source: STRINGDB
CALR
Tbio
Novelty: 0.00058349
Score: 0.545
Data Source: STRINGDB
GTF3C5
Tdark
Novelty: 0.66772655
Score: 0.535
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.27

PubMed score by year
PubTator Score  4.81

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFL
1-70
DICSELNKLCQHFEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSL
70-140
IPLILDLMKEWIAHSEKLPRKVLQHVSEPQAHQESTRGAARPAQAIGTQPRATKHKCRQLTKASLKPRGC
140-210
SKPPWRPPGGKL
210-222
MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFLDICSELNKLCQHFEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSLIPLILDLMKEWIAHSEKLPRKVLQHVSEPQAHQESTRGAARPAQAIGTQPRATKHKCRQLTKASLKPRGCSKPPWRPPGGKL