You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TRIM44
Tripartite motif-containing protein 44

Protein Summary
Description
May play a role in the process of differentiation and maturation of neuronal cells (By similarity). May regulate the activity of TRIM17. Is a negative regulator of PAX6 expression (PubMed:26394807). This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000299413
  • ENSP00000299413
  • ENSG00000166326

Symbol
  • DIPB
  • AN3
  • MC7
  • DIPB
  • HSA249128
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.95
histone modification site profile
0.92
microRNA
0.85
transcription factor binding site profile
0.85
disease perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 137.13   (req: < 5)
Gene RIFs: 17   (req: <= 3)
Antibodies: 244   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 137.13   (req: >= 5)
Gene RIFs: 17   (req: > 3)
Antibodies: 244   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (80)
1 – 10 of 80
ZNF254
Tdark
Family: TF
Novelty: 2.51908397
p_int: 0.999999999
p_ni: 1e-9
Data Source: BioPlex
DACH1
Tbio
Novelty: 0.0023329
p_int: 0.999999989
p_ni: 9e-9
p_wrong: 2e-9
Data Source: BioPlex
TRIM10
Tdark
Novelty: 0.73559461
p_int: 0.999999943
p_ni: 4.4e-8
p_wrong: 1.3e-8
Score: 0.261
Data Source: BioPlex,STRINGDB
RNF187
Tbio
Family: Enzyme
Novelty: 0.29411765
p_int: 0.999999928
p_ni: 5.8e-8
p_wrong: 1.5e-8
Data Source: BioPlex
TRIM47
Tbio
Novelty: 0.00571827
p_int: 0.999999881
p_ni: 9.7e-8
p_wrong: 2.2e-8
Score: 0.189
Data Source: BioPlex,STRINGDB
CDCA8
Tbio
Novelty: 0.02218432
p_int: 0.99999953
p_ni: 3.98e-7
p_wrong: 7.3e-8
Data Source: BioPlex
SPATS2L
Tbio
Novelty: 0.05130241
p_int: 0.99999944
p_ni: 5.6e-7
Score: 0.173
Data Source: BioPlex,STRINGDB
CCDC15
Tdark
Novelty: 13
p_int: 0.999997786
p_ni: 1.56e-7
p_wrong: 0.000002057
Score: 0.225
Data Source: BioPlex,STRINGDB
FEM1B
Tbio
Novelty: 0.07122869
p_int: 0.999996283
p_ni: 0.000003717
Data Source: BioPlex
TRIM17
Tbio
Family: Enzyme
Novelty: 0.01067656
p_int: 0.999994349
p_ni: 0.000005649
p_wrong: 3e-9
Score: 0.768
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  137.13

PubMed score by year
PubTator Score  43.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPP
1-70
ADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESE
70-140
AEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGH
140-210
QLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHL
210-280
VDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
280-344
MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT