You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ANAPC16
Anaphase-promoting complex subunit 16

Protein Summary
Description
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000299381
  • ENSP00000299381
  • ENSG00000166295
  • ENST00000621663
  • ENSP00000477760

Symbol
  • C10orf104
  • CENP-27
  • MSAG
  • APC16
  • CENP-27
  • C10orf104
  • bA570G20.3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.98
disease perturbation
0.87
histone modification site profile
0.86
transcription factor perturbation
0.84
small molecule perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.31   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 13   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.31   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 13   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (11)
1 – 5 of 11
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (34)
APC-Cdc20 mediated degradation of Nek2A (R-HSA-179409)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 33
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
APC-Cdc20 mediated degradation of Nek2A
Reactome
APC/C-mediated degradation of cell cycle proteins
Reactome
APC/C:Cdc20 mediated degradation of Cyclin B
Reactome
APC/C:Cdc20 mediated degradation of Securin
Reactome
APC/C:Cdc20 mediated degradation of mitotic proteins
Name
Explore in Pharos
Explore in Source
APC-Cdc20 mediated degradation of Nek2A
APC/C-mediated degradation of cell cycle proteins
APC/C:Cdc20 mediated degradation of Cyclin B
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdc20 mediated degradation of mitotic proteins
Protein-Protein Interactions (155)
1 – 10 of 155
CDC27
Tbio
Novelty: 0.00956925
p_int: 0.999999777
p_ni: 2.18e-7
p_wrong: 5e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC2
Tbio
Family: Enzyme
Novelty: 0.25398893
p_int: 0.999999488
p_ni: 5.12e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC4
Tbio
Family: Enzyme
Novelty: 1.93548387
p_int: 0.999998798
p_ni: 0.000001196
p_wrong: 6e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
FBXO5
Tbio
Novelty: 0.01799521
p_int: 0.999998065
p_ni: 0.000001913
p_wrong: 2.2e-8
Score: 0.911
Data Source: BioPlex,STRINGDB
FZR1
Tbio
Novelty: 0.01409033
p_int: 0.999993689
p_ni: 0.000006311
Score: 0.991
Data Source: BioPlex,STRINGDB
CDC23
Tbio
Novelty: 0.02675154
p_int: 0.999991546
p_ni: 0.000008453
p_wrong: 1e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC1
Tbio
Family: Enzyme
Novelty: 0.02248926
p_int: 0.999984695
p_ni: 0.000015305
Score: 0.999
Data Source: BioPlex,STRINGDB
CDC26
Tbio
Family: Enzyme
Novelty: 0.12631579
p_int: 0.999978285
p_ni: 0.000021584
p_wrong: 1.33e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC5
Tbio
Family: Enzyme
Novelty: 0.0345899
p_int: 0.999976027
p_ni: 0.000023971
p_wrong: 3e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC7
Tbio
Family: Enzyme
Novelty: 0.39914469
p_int: 0.999886888
p_ni: 0.000113112
Score: 0.999
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  11.31

PubMed score by year
PubTator Score  4.47

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQV
1-70
KHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG
70-110
MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG