You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
COQ8B
Atypical kinase COQ8B, mitochondrial

Protein Summary
Description
Atypical kinase involved in the biosynthesis of coenzyme Q, also named ubiquinone, an essential lipid-soluble electron transporter for aerobic cellular respiration (PubMed:24270420). Its substrate specificity is unclear: does not show any protein kinase activity. Probably acts as a small molecule kinase, possibly a lipid kinase that phosphorylates a prenyl lipid in the ubiquinone biosynthesis pathway. Required for podocyte migration (PubMed:24270420). This gene encodes a protein with two copies of a domain found in protein kinases. The encoded protein has a complete protein kinase catalytic domain, and a truncated domain that contains only the active and binding sites of the protein kinase domain, however, it is not known whether the protein has any kinase activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000243583
  • ENSP00000243583
  • ENSG00000123815
  • ENST00000324464
  • ENSP00000315118

Symbol
  • ADCK4
  • ADCK4
  • NPHS9
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.27   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 213   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.27   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 213   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL386051
chemical structure image
Gene Ontology Terms (10)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (53)
1 – 10 of 53
CD70
Tbio
Novelty: 0.00552433
p_int: 0.959722568
p_ni: 0.040277432
Data Source: BioPlex
VIPR2
Tchem
Family: GPCR
Novelty: 0.00602252
p_int: 0.958236716
p_ni: 0.041763284
Data Source: BioPlex
CD27
Tbio
Novelty: 0.00109406
p_int: 0.944884206
p_ni: 0.055115794
Score: 0.535
Data Source: BioPlex,STRINGDB
SLC2A12
Tbio
Family: Transporter
Novelty: 0.02003135
p_int: 0.901530768
p_ni: 0.098469232
Score: 0.17
Data Source: BioPlex,STRINGDB
CMKLR1
Tchem
Family: GPCR
Novelty: 0.00748603
p_int: 0.875450285
p_ni: 0.124549715
Data Source: BioPlex
C5AR2
Tbio
Family: GPCR
Novelty: 0.01354267
p_int: 0.861459292
p_ni: 0.138540708
Data Source: BioPlex
P2RX4
Tchem
Family: IC
Novelty: 0.00292374
p_int: 0.803686881
p_ni: 0.196313119
Score: 0.2
Data Source: BioPlex,STRINGDB
APLNR
Tchem
Family: GPCR
Novelty: 0.001441
p_int: 0.803502451
p_ni: 0.196497549
Data Source: BioPlex
COQ9
Tbio
Novelty: 0.005822
Score: 0.963
Data Source: STRINGDB
COQ6
Tbio
Family: Enzyme
Novelty: 0.03821723
Score: 0.95
Data Source: STRINGDB
Publication Statistics
PubMed Score  23.27

PubMed score by year
PubTator Score  8.92

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MWLKVGGLLRGTGGQLGQTVGWPCGALGPGPHRWGPCGGSWAQKFYQDGPGRGLGEEDIRRAREARPRKT
1-70
PRPQLSDRSRERKVPASRISRLANFGGLAVGLGLGVLAEMAKKSMPGGRLQSEGGSGLDSSPFLSEANAE
70-140
RIVQTLCTVRGAALKVGQMLSIQDNSFISPQLQHIFERVRQSADFMPRWQMLRVLEEELGRDWQAKVASL
140-210
EEVPFAAASIGQVHQGLLRDGTEVAVKIQYPGIAQSIQSDVQNLLAVLKMSAALPAGLFAEQSLQALQQE
210-280
LAWECDYRREAACAQNFRQLLANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQDLRNQICFQL
280-350
LTLCLRELFEFRFMQTDPNWANFLYDASSHQVTLLDFGASREFGTEFTDHYIEVVKAAADGDRDCVLQKS
350-420
RDLKFLTGFETKAFSDAHVEAVMILGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCPPPEETYALHR
420-490
KLAGAFLACAHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSWVDPS
490-544
MWLKVGGLLRGTGGQLGQTVGWPCGALGPGPHRWGPCGGSWAQKFYQDGPGRGLGEEDIRRAREARPRKTPRPQLSDRSRERKVPASRISRLANFGGLAVGLGLGVLAEMAKKSMPGGRLQSEGGSGLDSSPFLSEANAERIVQTLCTVRGAALKVGQMLSIQDNSFISPQLQHIFERVRQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQYPGIAQSIQSDVQNLLAVLKMSAALPAGLFAEQSLQALQQELAWECDYRREAACAQNFRQLLANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQDLRNQICFQLLTLCLRELFEFRFMQTDPNWANFLYDASSHQVTLLDFGASREFGTEFTDHYIEVVKAAADGDRDCVLQKSRDLKFLTGFETKAFSDAHVEAVMILGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCPPPEETYALHRKLAGAFLACAHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSWVDPS