You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KCTD12
BTB/POZ domain-containing protein KCTD12

Protein Classes
Protein Summary
Description
Auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. Increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000377474
  • ENSP00000366694
  • ENSG00000178695

Symbol
  • C13orf2
  • KIAA1778
  • PFET1
  • PFET1
  • PFETIN
  • C13orf2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
1
interacting protein
0.93
PubMedID
0.9
cell type or tissue
0.86
microRNA
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 27.89   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 131   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 27.89   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 131   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (51)
1 – 10 of 51
CHTF8
Tdark
Novelty: 0.21878798
p_int: 0.999998982
p_ni: 0.000001017
p_wrong: 1e-9
Data Source: BioPlex
PIF1
Tbio
Family: Enzyme
Novelty: 0.00536114
p_int: 0.999998546
p_ni: 0.000001426
p_wrong: 2.8e-8
Data Source: BioPlex
ARHGEF39
Tdark
Novelty: 0.44887781
p_int: 0.99999732
p_ni: 0.000002667
p_wrong: 1.3e-8
Data Source: BioPlex
KCTD16
Tdark
Novelty: 0.1415969
p_int: 0.999958312
p_ni: 6.3e-8
p_wrong: 0.000041625
Data Source: BioPlex
PUSL1
Tdark
Family: Enzyme
p_int: 0.999943906
p_ni: 0.000056091
p_wrong: 4e-9
Data Source: BioPlex
ZIC2
Tbio
Family: TF
Novelty: 0.01186234
p_int: 0.99987167
p_ni: 0.00007549
p_wrong: 0.00005284
Data Source: BioPlex
GTF2F1
Tbio
Novelty: 0.0252356
p_int: 0.998508642
p_ni: 0.001491358
Data Source: BioPlex
ENDOG
Tbio
Family: Enzyme
Novelty: 0.00557198
p_int: 0.997653194
p_ni: 0.00233799
p_wrong: 0.000008816
Data Source: BioPlex
GNG2
Tbio
Novelty: 0.08273543
p_int: 0.99710291
p_ni: 0.00289709
Data Source: BioPlex
DNAH14
Tdark
Novelty: 0.46713107
p_int: 0.996504648
p_ni: 0.003370586
p_wrong: 0.000124766
Data Source: BioPlex
Publication Statistics
PubMed Score  27.89

PubMed score by year
PubTator Score  22.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALADSTRGLPNGGGGGGGSGSSSSSAEPPLFPDIVELNVGGQVYVTRRCTVVSVPDSLLWRMFTQQQPQ
1-70
ELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERSRLQREAEYFELPELVRRLGAPQQPGPGPP
70-140
PSRRGVHKEGSLGDELLPLGYSEPEQQEGASAGAPSPTLELASRSPSGGAAGPLLTPSQSLDGSRRSGYI
140-210
TIGYRGSYTIGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLKFNFLEQA
210-280
FDKLSESGFHMVACSSTGTCAFASSTDQSEDKIWTSYTEYVFCRE
280-325
MALADSTRGLPNGGGGGGGSGSSSSSAEPPLFPDIVELNVGGQVYVTRRCTVVSVPDSLLWRMFTQQQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERSRLQREAEYFELPELVRRLGAPQQPGPGPPPSRRGVHKEGSLGDELLPLGYSEPEQQEGASAGAPSPTLELASRSPSGGAAGPLLTPSQSLDGSRRSGYITIGYRGSYTIGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQSEDKIWTSYTEYVFCRE