You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CHMP4C
Charged multivesicular body protein 4c

Protein Classes
Protein Summary
Description
Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). Key component of the cytokinesis checkpoint, a process required to delay abscission to prevent both premature r ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000297265
  • ENSP00000297265
  • ENSG00000164695

Symbol
  • SHAX3
  • Shax3
  • SNF7-3
  • VPS32C
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.77
gene perturbation
0.76
biological process
0.64
cellular component
0.62
transcription factor perturbation
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.82   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 62   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.82   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 62   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
Autophagy (R-HSA-9612973)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Autophagy
Reactome
Budding and maturation of HIV virion
Reactome
Cellular responses to external stimuli
Reactome
Disease
Reactome
Endosomal Sorting Complex Required For Transport (ESCRT)
Name
Explore in Pharos
Explore in Source
Autophagy
Budding and maturation of HIV virion
Cellular responses to external stimuli
Disease
Endosomal Sorting Complex Required For Transport (ESCRT)
Gene Ontology Terms (24)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (81)
1 – 10 of 81
CHMP2A
Tbio
Novelty: 0.00337804
Score: 0.994
Data Source: STRINGDB
CHMP5
Tbio
Novelty: 0.03824259
Score: 0.992
Data Source: STRINGDB
VPS4B
Tbio
Novelty: 0.00983426
Score: 0.992
Data Source: STRINGDB
VPS4A
Tbio
Novelty: 0.01985299
Score: 0.991
Data Source: STRINGDB
PDCD6IP
Tbio
Novelty: 0.02402814
Score: 0.99
Data Source: STRINGDB
VPS25
Tbio
Novelty: 0.05198234
Score: 0.977
Data Source: STRINGDB
TSG101
Tbio
Novelty: 0.00310287
Score: 0.973
Data Source: STRINGDB
SNF8
Tbio
Novelty: 0.0473195
Score: 0.971
Data Source: STRINGDB
CHMP2B
Tbio
Novelty: 0.01676728
Score: 0.97
Data Source: STRINGDB
VPS37C
Tbio
Novelty: 0.36129032
Score: 0.967
Data Source: STRINGDB
Publication Statistics
PubMed Score  8.82

PubMed score by year
PubTator Score  10.68

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALK
1-70
RKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD
70-140
IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRS
140-210
RAASSQRAEEEDDDIKQLAAWAT
210-233
MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT