You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PPCDC
Phosphopantothenoylcysteine decarboxylase

Protein Summary
Description
Necessary for the biosynthesis of coenzyme A. Catalyzes the decarboxylation of 4-phosphopantothenoylcysteine to form 4'-phosphopantotheine. Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC (EC 4.1.1.36), one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopantetheine (Daugherty et al., 2002 [PubMed 11923312]).[supplied by OMIM, Mar 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000342932
  • ENSP00000343190
  • ENSG00000138621

Symbol
  • COAC
  • coaC
  • MDS018
  • PPC-DC
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.84
tissue sample
0.72
histone modification site profile
0.68
biological process
0.58
transcription factor
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.65   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 86   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.65   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 86   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
Coenzyme A biosynthesis (R-HSA-196783)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Coenzyme A biosynthesis
Reactome
Metabolism
Reactome
Metabolism of vitamins and cofactors
Reactome
Metabolism of water-soluble vitamins and cofactors
Reactome
Vitamin B5 (pantothenate) metabolism
Name
Explore in Pharos
Explore in Source
Coenzyme A biosynthesis
Metabolism
Metabolism of vitamins and cofactors
Metabolism of water-soluble vitamins and cofactors
Vitamin B5 (pantothenate) metabolism
Protein-Protein Interactions (55)
1 – 10 of 55
PPCS
Tbio
Family: Enzyme
Novelty: 0.01489362
Score: 0.997
Data Source: STRINGDB
COASY
Tbio
Family: Enzyme
Novelty: 0.00555161
Score: 0.997
Data Source: STRINGDB
PANK2
Tbio
Family: Kinase
Novelty: 0.00556645
Score: 0.971
Data Source: STRINGDB
PANK1
Tbio
Family: Kinase
Novelty: 0.01345967
Score: 0.971
Data Source: STRINGDB
PANK4
Tdark
Family: Kinase
Novelty: 0.23450586
Score: 0.97
Data Source: STRINGDB
PANK3
Tchem
Family: Kinase
Novelty: 0.08579865
Score: 0.956
Data Source: STRINGDB
ENPP1
Tchem
Family: Enzyme
Novelty: 0.00170149
Score: 0.902
Data Source: STRINGDB
ENPP3
Tbio
Family: Enzyme
Novelty: 0.00239972
Score: 0.902
Data Source: STRINGDB
PPP1CC
Tchem
Family: Enzyme
Novelty: 0.00538884
Score: 0.823
Data Source: STRINGDB
PPP1CA
Tchem
Family: Enzyme
Novelty: 0.00685545
Score: 0.817
Data Source: STRINGDB
Publication Statistics
PubMed Score  38.65

PubMed score by year
PubTator Score  6.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFYSPQDIPVTLY
1-70
SDADEWEIWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMN
70-140
TAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQHSGFQQS
140-204
MEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQHSGFQQS