You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SKA1
Spindle and kinetochore-associated protein 1

Protein Summary
Description
Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation (PubMed:17093495, PubMed:19289083, PubMed:23085020). Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint (PubMed:17093495). The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies (PubMed:19289083). The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner (PubMed:19289083). Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules (PubMed:23085020). In the complex, it mediates the interaction with microtubules (PubMed:19289083, PubMed:23085020).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000285116
  • ENSP00000285116
  • ENSG00000154839
  • ENST00000398452
  • ENSP00000381470
  • ENST00000417656
  • ENSP00000397222
  • ENST00000571751
  • ENSP00000458992
  • ENSG00000262634
  • ENST00000616604
  • ENSP00000478259
  • ENST00000633940
  • ENSP00000488815

Symbol
  • C18orf24
  • C18orf24
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.9
kinase perturbation
0.88
transcription factor perturbation
0.61
small molecule perturbation
0.6
cellular component
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.82   (req: < 5)
Gene RIFs: 23   (req: <= 3)
Antibodies: 84   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.82   (req: >= 5)
Gene RIFs: 23   (req: > 3)
Antibodies: 84   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (16)
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal (R-HSA-141444)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Reactome
Amplification of signal from the kinetochores
Reactome
Cell Cycle
Reactome
Cell Cycle Checkpoints
Reactome
Cell Cycle, Mitotic
Name
Explore in Pharos
Explore in Source
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Amplification of signal from the kinetochores
Cell Cycle
Cell Cycle Checkpoints
Cell Cycle, Mitotic
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (220)
1 – 10 of 220
SKA3
Tbio
Novelty: 0.08112545
p_int: 0.999999994
p_ni: 3e-9
p_wrong: 2e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
SNAP29
Tbio
Novelty: 0.02549569
p_int: 0.999998253
p_ni: 0.000001747
Score: 0.389
Data Source: BioPlex,STRINGDB
NAP1L5
Tbio
Novelty: 0.14224726
p_int: 0.999920977
p_ni: 0.000078292
p_wrong: 7.31e-7
Score: 0.183
Data Source: BioPlex,STRINGDB
PYCR2
Tbio
Family: Enzyme
Novelty: 0.11491584
p_int: 0.999908896
p_ni: 0.000089817
p_wrong: 0.000001288
Score: 0.672
Data Source: BioPlex,STRINGDB
FAM9C
Tdark
Novelty: 1.42857143
p_int: 0.999873584
p_ni: 0.000120941
p_wrong: 0.000005475
Data Source: BioPlex
PSMC5
Tbio
Family: Enzyme
Novelty: 0.01964643
p_int: 0.999823216
p_ni: 0.000176781
p_wrong: 2e-9
Data Source: BioPlex
BLOC1S6
Tbio
Novelty: 0.00418729
p_int: 0.999327221
p_ni: 0.000472718
p_wrong: 0.000200061
Score: 0.224
Data Source: BioPlex,STRINGDB
LHFPL2
Tdark
Novelty: 0.49469965
p_int: 0.999267938
p_ni: 0.000589432
p_wrong: 0.000142631
Data Source: BioPlex
PPP2R2C
Tbio
Family: Enzyme
Novelty: 0.06762579
p_int: 0.937741503
p_ni: 0.00059301
p_wrong: 0.061665487
Score: 0.558
Data Source: BioPlex,STRINGDB
SKA2
Tbio
Novelty: 0.05111614
Score: 0.998
Data Source: STRINGDB
Publication Statistics
PubMed Score  37.82

PubMed score by year
PubTator Score  31.06

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSL
1-70
KELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFI
70-140
TCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYF
140-210
IVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT
210-255
MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFITCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT