You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DACT3
Dapper homolog 3

Protein Summary
Description
May be involved in regulation of intracellular signaling pathways during development. Specifically thought to play a role in canonical and/or non-canonical Wnt signaling pathways through interaction with DSH (Dishevelled) family proteins.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000391916
  • ENSP00000375783
  • ENSG00000197380

Symbol
  • RRR1
  • RRR1
  • DAPPER3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.8
transcription factor binding site profile
0.64
biological process
0.54
tissue sample
0.53
cell line
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 66.76   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 194   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 66.76   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 194   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (12)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (21)
1 – 10 of 21
SESTD1
Tbio
Novelty: 0.1805301
p_int: 0.999999989
p_ni: 9e-9
p_wrong: 2e-9
Score: 0.252
Data Source: BioPlex,STRINGDB
TRAT1
Tbio
Novelty: 0.00064556
p_int: 0.999994706
p_ni: 0.000003851
p_wrong: 0.000001443
Data Source: BioPlex
IFT22
Tdark
Family: Enzyme
Novelty: 0.48997773
p_int: 0.997068989
p_ni: 0.002930959
p_wrong: 5.2e-8
Data Source: BioPlex
PKD2
Tchem
Family: IC
Novelty: 0.00208049
p_int: 0.954108415
p_ni: 0.045891403
p_wrong: 1.83e-7
Data Source: BioPlex
SLC38A2
Tbio
Family: Transporter
Novelty: 0.01178113
p_int: 0.786307522
p_ni: 0.213692477
p_wrong: 2e-9
Data Source: BioPlex
DACT2
Tbio
Novelty: 0.06119733
Score: 0.867
Data Source: STRINGDB
RRS1
Tbio
Novelty: 0.00929224
Score: 0.789
Data Source: STRINGDB
GNG8
Tdark
Novelty: 0.00694874
Score: 0.633
Data Source: STRINGDB
DVL1
Tchem
Novelty: 0.00460899
Score: 0.53
Data Source: STRINGDB
RCCD1
Tbio
Novelty: 0.10479042
Score: 0.525
Data Source: STRINGDB
Publication Statistics
PubMed Score  66.76

PubMed score by year
PubTator Score  153.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MIRAFSFPVSPERGRLRGWLEGSLAGLCELHWLRERQEYRVQQALRLAQPGMGGAEAEDEEDADEDEDAA
1-70
AARRAAAALEEQLEALPGLVWDLGQQLGDLSLESGGLEQESGRSSGFYEDPSSTGGPDSPPSTFCGDSGF
70-140
SGSSSYGRLGPSEPRGIYASERPKSLGDASPSAPEVVGARAAVPRSFSAPYPTAGGSAGPEACSSAERRA
140-210
RAGPFLTPSPLHAVAMRSPRPCGRPPTDSPDAGGAGRPLDGYISALLRRRRRRGAGQPRTSPGGADGGPR
210-280
RQNSVRQRPPDASPSPGSARPAREPSLERVGGHPTSPAALSRAWASSWESEAAPEPAAPPAAPSPPDSPA
280-350
EGRLVKAQYIPGAQAATRGLPGRAARRKPPPLTRGRSVEQSPPRERPRAAGRRGRMAEASGRRGSPRARK
350-420
ASRSQSETSLLGRASAVPSGPPKYPTAEREEPRPPRPRRGPAPTLAAQAAGSCRRWRSTAEIDAADGRRV
420-490
RPRAPAARVPGPGPSPSAPQRRLLYGCAGSDSECSAGRLGPLGRRGPAGGVGGGYGESESSASEGESPAF
490-560
SSASSDSDGSGGLVWPQQLVAATAASGGGAGAGAPAGPAKVFVKIKASHALKKKILRFRSGSLKVMTTV
560-629
MIRAFSFPVSPERGRLRGWLEGSLAGLCELHWLRERQEYRVQQALRLAQPGMGGAEAEDEEDADEDEDAAAARRAAAALEEQLEALPGLVWDLGQQLGDLSLESGGLEQESGRSSGFYEDPSSTGGPDSPPSTFCGDSGFSGSSSYGRLGPSEPRGIYASERPKSLGDASPSAPEVVGARAAVPRSFSAPYPTAGGSAGPEACSSAERRARAGPFLTPSPLHAVAMRSPRPCGRPPTDSPDAGGAGRPLDGYISALLRRRRRRGAGQPRTSPGGADGGPRRQNSVRQRPPDASPSPGSARPAREPSLERVGGHPTSPAALSRAWASSWESEAAPEPAAPPAAPSPPDSPAEGRLVKAQYIPGAQAATRGLPGRAARRKPPPLTRGRSVEQSPPRERPRAAGRRGRMAEASGRRGSPRARKASRSQSETSLLGRASAVPSGPPKYPTAEREEPRPPRPRRGPAPTLAAQAAGSCRRWRSTAEIDAADGRRVRPRAPAARVPGPGPSPSAPQRRLLYGCAGSDSECSAGRLGPLGRRGPAGGVGGGYGESESSASEGESPAFSSASSDSDGSGGLVWPQQLVAATAASGGGAGAGAPAGPAKVFVKIKASHALKKKILRFRSGSLKVMTTV