You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
COL26A1
Collagen alpha-1(XXVI) chain

Protein Summary
Description
This gene encodes a protein containing an emilin domain and two collagen stretches. This gene may be associated with aspirin-intolerant asthma. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000313669
  • ENSP00000318234
  • ENSG00000160963
  • ENST00000613501
  • ENSP00000482102

Symbol
  • EMID2
  • EMU2
  • EMI6
  • EMU2
  • SH2B
  • EMID2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.77
transcription factor binding site profile
0.71
PubMedID
0.61
phenotype
0.6
transcription factor
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.32   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 147   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.32   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 147   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Collagen biosynthesis and modifying enzymes (R-HSA-1650814)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Collagen biosynthesis and modifying enzymes
Reactome
Collagen chain trimerization
Reactome
Collagen degradation
Reactome
Collagen formation
Reactome
Degradation of the extracellular matrix
Name
Explore in Pharos
Explore in Source
Collagen biosynthesis and modifying enzymes
Collagen chain trimerization
Collagen degradation
Collagen formation
Degradation of the extracellular matrix
Gene Ontology Terms (8)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (77)
1 – 10 of 77
LAIR2
Tbio
Novelty: 0.08746052
p_int: 0.999758628
p_ni: 0.000032013
p_wrong: 0.000209359
Data Source: BioPlex
VWCE
Tbio
Novelty: 0.10129635
p_int: 0.997880262
p_ni: 0.000317579
p_wrong: 0.001802159
Score: 0.243
Data Source: BioPlex,STRINGDB
SERPINH1
Tbio
Novelty: 0.00133506
Score: 0.992
Data Source: STRINGDB
COL23A1
Tbio
Novelty: 0.26409558
Score: 0.95
Data Source: STRINGDB
COL4A1
Tbio
Novelty: 0.00485546
Score: 0.929
Data Source: STRINGDB
COL4A3
Tbio
Novelty: 0.00369687
Score: 0.928
Data Source: STRINGDB
COL1A2
Tbio
Novelty: 0.00057274
Score: 0.928
Data Source: STRINGDB
COL25A1
Tbio
Novelty: 0.08502024
Score: 0.928
Data Source: STRINGDB
COL3A1
Tbio
Novelty: 0.00231183
Score: 0.926
Data Source: STRINGDB
COL1A1
Tbio
Novelty: 0.00095231
Score: 0.926
Data Source: STRINGDB
Publication Statistics
PubMed Score  10.32

PubMed score by year
PubTator Score  5.2

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKLALLLPWACCCLCGSALATGFLYPFSAAALQQHGYPEPGAGSPGSGYASRRHWCHHTVTRTVSCQVQN
1-70
GSETVVQRVYQSCRWPGPCANLVSYRTLIRPTYRVSYRTVTVLEWRCCPGFTGSNCDEECMNCTRLSDMS
70-140
ERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVPRQRRPTGPAGPPGQTGPP
140-210
GPAGPPGSKGDRGQTGEKGPAGPPGLLGPPGPRGLPGEMGRPGPPGPPGPAGNPGPSPNSPQGALYSLQP
210-280
PTDKDNGDSRLASAIVDTVLAGVPGPRGPPGPPGPPGPRGPPGPPGTPGSQGLAGERGTVGPSGEPGVKG
280-350
EEGEKAATAEGEGVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKRGGAQPDGV
350-420
LAALLGPDPGQKSVDQASSRK
420-441
MKLALLLPWACCCLCGSALATGFLYPFSAAALQQHGYPEPGAGSPGSGYASRRHWCHHTVTRTVSCQVQNGSETVVQRVYQSCRWPGPCANLVSYRTLIRPTYRVSYRTVTVLEWRCCPGFTGSNCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVPRQRRPTGPAGPPGQTGPPGPAGPPGSKGDRGQTGEKGPAGPPGLLGPPGPRGLPGEMGRPGPPGPPGPAGNPGPSPNSPQGALYSLQPPTDKDNGDSRLASAIVDTVLAGVPGPRGPPGPPGPPGPRGPPGPPGTPGSQGLAGERGTVGPSGEPGVKGEEGEKAATAEGEGVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKRGGAQPDGVLAALLGPDPGQKSVDQASSRK