You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ADIPOR1
Adiponectin receptor protein 1

Protein Classes
Protein Summary
Description
Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism (PubMed:25855295, PubMed:12802337). Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin (By similarity). This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000340990
  • ENSP00000341785
  • ENSG00000159346

Symbol
  • PAQR1
  • TESBP1A
  • CGI45
  • PAQR1
  • ACDCR1
  • CGI-45
  • TESBP1A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.93
kinase perturbation
0.91
transcription factor binding site profile
0.76
disease perturbation
0.74
disease
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 269.19   (req: < 5)
Gene RIFs: 181   (req: <= 3)
Antibodies: 370   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 269.19   (req: >= 5)
Gene RIFs: 181   (req: > 3)
Antibodies: 370   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 23
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (19)
AMPK inhibits chREBP transcriptional activation activity (R-HSA-163680)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
AMPK inhibits chREBP transcriptional activation activity
Reactome
Integration of energy metabolism
Reactome
Metabolism
Name
Explore in Pharos
Explore in Source
AMPK inhibits chREBP transcriptional activation activity
Integration of energy metabolism
Metabolism
Gene Ontology Terms (27)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (87)
1 – 10 of 87
FAM45A
Tdark
Novelty: 2
p_int: 0.999990124
p_ni: 0.000009876
Data Source: BioPlex
NT5E
Tchem
Family: Enzyme
Novelty: 0.00121213
p_int: 0.996432562
p_ni: 0.003566553
p_wrong: 8.85e-7
Data Source: BioPlex
GNAI2
Tbio
Novelty: 0.04542644
p_int: 0.969379759
p_ni: 0.030300607
p_wrong: 0.000319634
Score: 0.241
Data Source: BioPlex,STRINGDB
SPPL2B
Tbio
Family: Enzyme
Novelty: 0.03749833
p_int: 0.96370623
p_ni: 0.036293544
p_wrong: 2.26e-7
Data Source: BioPlex
MRAP2
Tbio
Novelty: 0.05863056
p_int: 0.937313041
p_ni: 0.061871824
p_wrong: 0.000815135
Data Source: BioPlex
TMEM171
Tdark
Novelty: 5.91917098
p_int: 0.934832924
p_ni: 0.065166615
p_wrong: 4.6e-7
Data Source: BioPlex
TACR1
Tclin
Family: GPCR
Novelty: 0.00074286
p_int: 0.933948968
p_ni: 0.066050966
p_wrong: 6.6e-8
Data Source: BioPlex
SLC18A1
Tchem
Family: Transporter
Novelty: 0.01036678
p_int: 0.928834525
p_ni: 0.070741314
p_wrong: 0.000424161
Data Source: BioPlex
WFS1
Tbio
Novelty: 0.00217461
p_int: 0.9092768
p_ni: 0.0907232
Score: 0.299
Data Source: BioPlex,STRINGDB
TMEM231
Tbio
Novelty: 0.22861101
p_int: 0.818143187
p_ni: 0.173492195
p_wrong: 0.008364618
Data Source: BioPlex
Publication Statistics
PubMed Score  269.19

PubMed score by year
PubTator Score  225.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLP
1-70
LQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWT
70-140
HLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYS
140-210
GIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVV
210-280
PTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFV
280-350
HFYGVSNLQEFRYGLEGGCTDDTLL
350-375
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL