You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RNF34
E3 ubiquitin-protein ligase RNF34

Protein Summary
Description
E3 ubiquitin-protein ligase that regulates several biological processes through the ubiquitin-mediated proteasomal degradation of various target proteins. Ubiquitinates the caspases CASP8 and CASP10, promoting their proteasomal degradation, to negatively regulate cell death downstream of death domain receptors in the extrinsic pathway of apoptosis (PubMed:15069192). May mediate 'Lys-48'-linked polyubiquitination of RIPK1 and its subsequent proteasomal degradation thereby indirectly regulating the tumor necrosis factor-mediated signaling pathway (Ref.13). Negatively regulates p53/TP53 through its direct ubiquitination and targeting to proteasomal degradation (PubMed:17121812). Indirectly, may also negatively regulate p53/TP53 through ubiquitination and degradation of SFN (PubMed:18382127). Mediates PPARGC1A proteasomal degradation probably through ubiquitination thereby indirectly regulating the metabolism of brown fat cells (PubMed:22064484). Possibly involved in innate immunity, throu ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000361234
  • ENSP00000355137
  • ENSG00000170633
  • ENST00000392465
  • ENSP00000376258

Symbol
  • RFI
  • RIF
  • RIFF
  • hRFI
  • CARP1
  • CARP-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.87
cell type or tissue
0.83
molecular function
0.81
disease perturbation
0.79
biological process
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 351.13   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 280   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 351.13   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 280   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (12)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen processing: Ubiquitination & Proteasome degradation
Reactome
Class I MHC mediated antigen processing & presentation
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen processing: Ubiquitination & Proteasome degradation
Class I MHC mediated antigen processing & presentation
Gene expression (Transcription)
Generic Transcription Pathway
Protein-Protein Interactions (291)
1 – 10 of 291
UNC119
Tchem
Novelty: 0.01278653
p_int: 0.99999999
p_ni: 1e-8
Score: 0.313
Data Source: BioPlex,STRINGDB
UNC119B
Tbio
Novelty: 0.3785489
p_int: 0.999929847
p_ni: 0.000070153
Score: 0.827
Data Source: BioPlex,STRINGDB
EFCAB7
Tdark
Novelty: 0.4787234
p_int: 0.999694542
p_ni: 0.00030545
p_wrong: 7e-9
Score: 0.251
Data Source: BioPlex,STRINGDB
SERPINB13
Tbio
Novelty: 0.03180119
p_int: 0.999317273
p_ni: 0.000088047
p_wrong: 0.00059468
Score: 0.185
Data Source: BioPlex,STRINGDB
KLHL15
Tbio
Novelty: 0.68181818
p_int: 0.997889296
p_ni: 0.002110704
Data Source: BioPlex
MANSC1
Tdark
Novelty: 1.42372881
p_int: 0.99572012
p_ni: 0.004246105
p_wrong: 0.000033776
Data Source: BioPlex
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.942080264
p_ni: 0.057919736
Data Source: BioPlex
TSR3
Tdark
Novelty: 0.18711019
p_int: 0.865906253
p_ni: 0.134093747
Score: 0.183
Data Source: BioPlex,STRINGDB
HSPA2
Tbio
Novelty: 0.01880681
p_int: 0.855240011
p_ni: 0.144759989
Score: 0.527
Data Source: BioPlex,STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.943
Data Source: STRINGDB
Publication Statistics
PubMed Score  351.13

PubMed score by year
PubTator Score  46.02

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFS
1-70
VFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREK
70-140
EDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPA
140-210
QVQSEITSANTEDDDDDDDEDDDDEEENAEDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNF
210-280
VNYSGCCEKWELVEKVNRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCG
280-350
KRMSECPICRQYVVRAVHVFKS
350-372
MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPAQVQSEITSANTEDDDDDDDEDDDDEEENAEDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAVHVFKS