You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
KISS1R
KiSS-1 receptor

Protein Summary
Description
Receptor for metastin (kisspeptin-54 or kp-54), a C-terminally amidated peptide of KiSS1. KiSS1 is a metastasis suppressor protein that suppresses metastases in malignant melanomas and in some breast carcinomas without affecting tumorigenicity. The metastasis suppressor properties may be mediated in part by cell cycle arrest and induction of apoptosis in malignant cells. The receptor is essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/KISS1R system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood. The receptor is also probably involved in the regulation and fine-tuning of trophoblast invasion generated by the trophoblast itself. Analysis of the transduction pathways activated by the receptor identifies coupling to phospholipase C and intracellular calcium release through pertussis toxin-insensitive G(q) proteins. The protein encoded by this gene is a galanin-like G protein-coupled recepto ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000234371
  • ENSP00000234371
  • ENSG00000116014

Symbol
  • AXOR12
  • GPR54
  • HH8
  • CPPB1
  • GPR54
  • AXOR12
  • KISS-1R
  • HOT7T175
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.9
biological process
0.77
biological term
0.7
phenotype
0.63
transcription factor
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 288.48   (req: < 5)
Gene RIFs: 75   (req: <= 3)
Antibodies: 315   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 288.48   (req: >= 5)
Gene RIFs: 75   (req: > 3)
Antibodies: 315   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 152
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Peptide ligand-binding receptors
Protein-Protein Interactions (206)
1 – 10 of 206
KISS1
Tbio
Novelty: 0.00111063
Score: 0.997
Data Source: Reactome,STRINGDB
GNRH1
Tbio
Novelty: 0.00024998
Score: 0.994
Data Source: STRINGDB
GNRHR
Tclin
Family: GPCR
Novelty: 0.00227536
Score: 0.979
Data Source: STRINGDB
TAC3
Tchem
Novelty: 0.00210451
Score: 0.979
Data Source: STRINGDB
PROK2
Tbio
Novelty: 0.00558025
Score: 0.965
Data Source: STRINGDB
NPS
Tbio
Novelty: 0.00011983
Score: 0.964
Data Source: STRINGDB
NPFF
Tbio
Novelty: 0.00350925
Score: 0.961
Data Source: STRINGDB
UTS2R
Tchem
Family: GPCR
Novelty: 0.01075176
Score: 0.957
Data Source: STRINGDB
GNRH2
Tbio
Novelty: 0.00305192
Score: 0.955
Data Source: STRINGDB
QRFP
Tbio
Novelty: 0.02279173
Score: 0.941
Data Source: STRINGDB
Publication Statistics
PubMed Score  288.48

PubMed score by year
PubTator Score  268.32

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGNSLVIYVICRH
1-70
KPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDR
70-140
WYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLALHRLSPGPRAYCSEAFPSRALERAFALYNLL
140-210
ALYLLPLLATCACYAAMLRHLGRVAVRPAPADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQ
210-280
LFLVLQALGPAGSWHPRSYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRR
280-350
PGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
350-398
MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGNSLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLALHRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAPADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL