You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TNFRSF14
Tumor necrosis factor receptor superfamily member 14

Protein Summary
Description
Receptor for BTLA. Receptor for TNFSF14/LIGHT and homotrimeric TNFSF1/lymphotoxin-alpha. Involved in lymphocyte activation. Plays an important role in HSV pathogenesis because it enhanced the entry of several wild-type HSV strains of both serotypes into CHO cells, and mediated HSV entry into activated human T-cells. (Microbial infection) Acts as a receptor for Herpes simplex virus 1/HHV-1. (Microbial infection) Acts as a receptor for Herpes simplex virus 2/HHV-2. This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000355716
  • ENSP00000347948
  • ENSG00000157873
  • ENST00000621877
  • ENSP00000478308
  • ENSG00000273936

Symbol
  • HVEA
  • HVEM
  • TR2
  • ATAR
  • HVEA
  • HVEM
  • CD270
  • LIGHTR
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.94
biological process
0.93
gene perturbation
0.76
ligand (protein)
0.68
transcription factor
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 301.01   (req: < 5)
Gene RIFs: 74   (req: <= 3)
Antibodies: 705   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 301.01   (req: >= 5)
Gene RIFs: 74   (req: > 3)
Antibodies: 705   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Costimulation by the CD28 family
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
TNFR2 non-canonical NF-kB pathway
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Costimulation by the CD28 family
Cytokine Signaling in Immune system
Immune System
TNFR2 non-canonical NF-kB pathway
Protein-Protein Interactions (78)
1 – 10 of 78
BTLA
Tbio
Novelty: 0.01059679
Score: 0.999
Data Source: Reactome,STRINGDB
TNFSF14
Tbio
Novelty: 0.01266766
Score: 0.995
Data Source: STRINGDB
LTA
Tbio
Novelty: 0.00126314
Score: 0.978
Data Source: Reactome,STRINGDB
PTPN11
Tchem
Family: Enzyme
Novelty: 0.00086268
Score: 0.957
Data Source: Reactome,STRINGDB
TRAF1
Tbio
Novelty: 0.00703177
Score: 0.943
Data Source: STRINGDB
TRAF5
Tbio
Novelty: 0.01881484
Score: 0.933
Data Source: STRINGDB
PTPN6
Tchem
Family: Enzyme
Novelty: 0.00619412
Score: 0.929
Data Source: Reactome,STRINGDB
TRAF3
Tbio
Novelty: 0.00292884
Score: 0.921
Data Source: STRINGDB
TRAF2
Tbio
Novelty: 0.01051586
Score: 0.921
Data Source: STRINGDB
CD160
Tbio
Novelty: 0.02046796
Score: 0.892
Data Source: STRINGDB
Publication Statistics
PubMed Score  301.01

PubMed score by year
PubTator Score  199.46

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGEL
1-70
TGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRA
70-140
YATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSL
140-210
VIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRS
210-280
PNH
280-283
MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH