You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GCDH
Glutaryl-CoA dehydrogenase, mitochondrial

Protein Summary
Description
Catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. Isoform Short is inactive. The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family. It catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. The enzyme exists in the mitochondrial matrix as a homotetramer of 45-kD subunits. Mutations in this gene result in the metabolic disorder glutaric aciduria type 1, which is also known as glutaric acidemia type I. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 12. [provided by RefSeq, Mar 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000222214
  • ENSP00000222214
  • ENSG00000105607
  • ENST00000591470
  • ENSP00000466845

Symbol
  • GCD
  • ACAD5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.99
kinase perturbation
0.97
transcription factor perturbation
0.8
cell type or tissue
0.73
protein domain
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 332.27   (req: < 5)
Gene RIFs: 26   (req: <= 3)
Antibodies: 238   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 332.27   (req: >= 5)
Gene RIFs: 26   (req: > 3)
Antibodies: 238   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (25)
Lysine catabolism (R-HSA-71064)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Lysine catabolism
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Name
Explore in Pharos
Explore in Source
Lysine catabolism
Metabolism
Metabolism of amino acids and derivatives
Protein-Protein Interactions (65)
1 – 10 of 65
ISCA1
Tbio
Novelty: 0.01855615
p_int: 0.961145986
p_ni: 0.038589105
p_wrong: 0.000264909
Score: 0.266
Data Source: BioPlex,STRINGDB
MARS2
Tbio
Family: Enzyme
Novelty: 0.03610718
p_int: 0.940274985
p_ni: 0.038393654
p_wrong: 0.021331361
Score: 0.522
Data Source: BioPlex,STRINGDB
ECHS1
Tbio
Family: Enzyme
Novelty: 0.01956365
Score: 0.965
Data Source: STRINGDB
ACOX1
Tbio
Family: Enzyme
Novelty: 0.00626693
Score: 0.948
Data Source: STRINGDB
HADHA
Tbio
Novelty: 0.00234785
Score: 0.946
Data Source: STRINGDB
ACADSB
Tbio
Family: Enzyme
Novelty: 0.04764309
Score: 0.944
Data Source: STRINGDB
EHHADH
Tbio
Novelty: 0.00763197
Score: 0.942
Data Source: STRINGDB
ACOX3
Tbio
Family: Enzyme
Novelty: 0.07064102
Score: 0.941
Data Source: STRINGDB
ACADM
Tbio
Family: Enzyme
Novelty: 0.00590747
Score: 0.93
Data Source: STRINGDB
OGDH
Tbio
Family: Enzyme
Novelty: 0.01059143
Score: 0.928
Data Source: STRINGDB
Publication Statistics
PubMed Score  332.27

PubMed score by year
PubTator Score  185.44

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALRGVSVRLLSRGPGLHVLRTWVSSAAQTEKGGRTQSQLAKSSRPEFDWQDPLVLEEQLTTDEILIRDT
1-70
FRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGVSSVAYGLLARELERVDSGYRSA
70-140
MSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRAHYNSSNKSYTLNGTK
140-210
TWITNSPMADLFVVWARCEDGCIRGFLLEKGMRGLSAPRIQGKFSLRASATGMIIMDGVEVPEENVLPGA
210-280
SSLGGPFGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHAC
280-350
LQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIH
350-420
ALILGRAITGIQAFTASK
420-438
MALRGVSVRLLSRGPGLHVLRTWVSSAAQTEKGGRTQSQLAKSSRPEFDWQDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGVSSVAYGLLARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRAHYNSSNKSYTLNGTKTWITNSPMADLFVVWARCEDGCIRGFLLEKGMRGLSAPRIQGKFSLRASATGMIIMDGVEVPEENVLPGASSLGGPFGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITGIQAFTASK