You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KHSRP
Far upstream element-binding protein 2

Protein Summary
Description
Binds to the dendritic targeting element and may play a role in mRNA trafficking (By similarity). Part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. Mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. May interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly by recruiting degradation machinery to ARE-containing mRNAs. The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization (Min et al., 1997 [PubMed 9136930]; Gherzi et al., 2004 [PubMed 15175153]).[supplied by OMIM, Apr 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000398148
  • ENSP00000381216
  • ENSG00000088247

Symbol
  • FUBP2
  • p75
  • FBP2
  • KSRP
  • FUBP2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
protein complex
0.92
co-expressed gene
0.82
transcription factor binding site profile
0.82
hub protein
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 101.27   (req: < 5)
Gene RIFs: 39   (req: <= 3)
Antibodies: 289   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 101.27   (req: >= 5)
Gene RIFs: 39   (req: > 3)
Antibodies: 289   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (8)
ATF4 activates genes in response to endoplasmic reticulum stress (R-HSA-380994)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ATF4 activates genes in response to endoplasmic reticulum stress
Reactome
KSRP (KHSRP) binds and destabilizes mRNA
Reactome
Metabolism of RNA
Reactome
Metabolism of proteins
Reactome
PERK regulates gene expression
Name
Explore in Pharos
Explore in Source
ATF4 activates genes in response to endoplasmic reticulum stress
KSRP (KHSRP) binds and destabilizes mRNA
Metabolism of RNA
Metabolism of proteins
PERK regulates gene expression
Gene Ontology Terms (21)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (205)
1 – 10 of 205
EXOSC2
Tbio
Novelty: 0.04406904
Score: 0.999
Data Source: STRINGDB
AKT1
Tchem
Family: Kinase
Novelty: 0.0000383
Score: 0.979
Data Source: Reactome,STRINGDB
PARN
Tbio
Family: Enzyme
Novelty: 0.01162807
Score: 0.976
Data Source: Reactome,STRINGDB
CPSF6
Tbio
Novelty: 0.02089561
Score: 0.973
Data Source: STRINGDB
MAPK14
Tchem
Family: Kinase
Novelty: 0.00018655
Score: 0.959
Data Source: Reactome,STRINGDB
EXOSC3
Tbio
Novelty: 0.05171042
Score: 0.952
Data Source: STRINGDB
KHDRBS1
Tbio
Novelty: 0.00737623
Score: 0.951
Data Source: STRINGDB
ELAVL1
Tchem
Novelty: 0.00158015
Score: 0.936
Data Source: STRINGDB
DCP2
Tbio
Family: Enzyme
Novelty: 0.00984421
Score: 0.932
Data Source: Reactome,STRINGDB
EXOSC4
Tbio
Family: Enzyme
Novelty: 0.00986567
Score: 0.931
Data Source: STRINGDB
Publication Statistics
PubMed Score  101.27

PubMed score by year
PubTator Score  68.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIR
1-70
KDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPP
70-140
PRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDD
140-210
IVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVD
210-280
KPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQN
280-350
DAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNW
350-420
GPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQL
420-490
IEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPH
490-560
DPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQPPPTGQSDYTKAWEEYYKKIG
560-630
QQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQP
630-700
PPTQQGQQQAQ
700-711
MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNWGPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ