You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MAP4K1
Mitogen-activated protein kinase kinase kinase kinase 1

Protein Summary
Description
Serine/threonine-protein kinase, which may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway. May play a role in hematopoietic lineage decisions and growth regulation. Able to autophosphorylate.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000396857
  • ENSP00000380066
  • ENSG00000104814
  • ENST00000591517
  • ENSP00000465039
  • ENST00000634395
  • ENSP00000489001
  • ENSG00000282928
  • ENST00000634494
  • ENSP00000489158

Symbol
  • HPK1
  • HPK1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
0.98
molecular function
0.96
drug perturbation
0.87
gene perturbation
0.87
kinase
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.92   (req: < 5)
Gene RIFs: 20   (req: <= 3)
Antibodies: 531   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.92   (req: >= 5)
Gene RIFs: 20   (req: > 3)
Antibodies: 531   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Protein-Protein Interactions (67)
1 – 10 of 67
DBNL
Tbio
Novelty: 0.04018498
Score: 0.996
Data Source: STRINGDB
GRAP2
Tbio
Novelty: 0.00186531
Score: 0.994
Data Source: STRINGDB
LCP2
Tbio
Novelty: 0.00631737
Score: 0.989
Data Source: STRINGDB
CRK
Tbio
Novelty: 0.00270563
Score: 0.975
Data Source: STRINGDB
LAT
Tbio
Novelty: 0.00738606
Score: 0.963
Data Source: STRINGDB
CRKL
Tbio
Novelty: 0.0061856
Score: 0.953
Data Source: STRINGDB
MAP3K11
Tchem
Family: Kinase
Novelty: 0.01297827
Score: 0.951
Data Source: STRINGDB
DAPP1
Tbio
Novelty: 0.07746533
Score: 0.949
Data Source: STRINGDB
MAP3K7
Tchem
Family: Kinase
Novelty: 0.00697684
Score: 0.947
Data Source: STRINGDB
LCK
Tclin
Family: Kinase
Novelty: 0.00040453
Score: 0.927
Data Source: STRINGDB
Publication Statistics
PubMed Score  36.92

PubMed score by year
PubTator Score  37.12

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MDVVDPDIFNRDPRDHYDLLQRLGGGTYGEVFKARDKVSGDLVALKMVKMEPDDDVSTLQKEILILKTCR
1-70
HANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKG
70-140
ANILINDAGEVRLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAE
140-210
LQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVSQPGLN
210-280
RGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETR
280-350
PPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPSDEGPGSMGDDGQL
350-420
SPGVLVRCASGPPPNSPRPGPPPSTSSPHLTAHSEPSLWNPPSRELDKPPLLPPKKEKMKRKGCALLVKL
420-490
FNGCPLRIHSTAAWTHPSTKDQHLLLGAEEGIFILNRNDQEATLEMLFPSRTTWVYSINNVLMSLSGKTP
490-560
HLYSHSILGLLERKETRAGNPIAHISPHRLLARKNMVSTKIQDTKGCRACCVAEGASSGGPFLCGALETS
560-630
VVLLQWYQPMNKFLLVRQVLFPLPTPLSVFALLTGPGSELPAVCIGVSPGRPGKSVLFHTVRFGALSCWL
630-700
GEMSTEHRGPVQVTQVEEDMVMVLMDGSVKLVTPEGSPVRGLRTPEIPMTEAVEAVAMVGGQLQAFWKHG
700-770
VQVWALGSDQLLQELRDPTLTFRLLGSPRLECSGTISPHCNLLLPGSSNSPASASRVAGITGL
770-833
MDVVDPDIFNRDPRDHYDLLQRLGGGTYGEVFKARDKVSGDLVALKMVKMEPDDDVSTLQKEILILKTCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILINDAGEVRLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVSQPGLNRGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPSDEGPGSMGDDGQLSPGVLVRCASGPPPNSPRPGPPPSTSSPHLTAHSEPSLWNPPSRELDKPPLLPPKKEKMKRKGCALLVKLFNGCPLRIHSTAAWTHPSTKDQHLLLGAEEGIFILNRNDQEATLEMLFPSRTTWVYSINNVLMSLSGKTPHLYSHSILGLLERKETRAGNPIAHISPHRLLARKNMVSTKIQDTKGCRACCVAEGASSGGPFLCGALETSVVLLQWYQPMNKFLLVRQVLFPLPTPLSVFALLTGPGSELPAVCIGVSPGRPGKSVLFHTVRFGALSCWLGEMSTEHRGPVQVTQVEEDMVMVLMDGSVKLVTPEGSPVRGLRTPEIPMTEAVEAVAMVGGQLQAFWKHGVQVWALGSDQLLQELRDPTLTFRLLGSPRLECSGTISPHCNLLLPGSSNSPASASRVAGITGL