You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC5A5
Sodium/iodide cotransporter

Protein Summary
Description
Mediates iodide uptake in the thyroid gland. This gene encodes a member of the sodium glucose cotransporter family. The encoded protein is responsible for the uptake of iodine in tissues such as the thyroid and lactating breast tissue. The iodine taken up by the thyroid is incorporated into the metabolic regulators triiodothyronine (T3) and tetraiodothyronine (T4). Mutations in this gene are associated with thyroid dyshormonogenesis 1.[provided by RefSeq, Sep 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000222248
  • ENSP00000222248
  • ENSG00000105641

Symbol
  • NIS
  • NIS
  • TDH1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.77
molecular function
0.76
chemical
0.71
PubMedID
0.59
cellular component
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1101.32   (req: < 5)
Gene RIFs: 117   (req: <= 3)
Antibodies: 527   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1101.32   (req: >= 5)
Gene RIFs: 117   (req: > 3)
Antibodies: 527   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (17)
Defective SLC5A5 causes thyroid dyshormonogenesis 1 (TDH1) (R-HSA-5619096)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Defective SLC5A5 causes thyroid dyshormonogenesis 1 (TDH1)
Reactome
Disease
Reactome
Disorders of transmembrane transporters
Reactome
Metabolism
Reactome
Metabolism of amine-derived hormones
Name
Explore in Pharos
Explore in Source
Defective SLC5A5 causes thyroid dyshormonogenesis 1 (TDH1)
Disease
Disorders of transmembrane transporters
Metabolism
Metabolism of amine-derived hormones
Protein-Protein Interactions (60)
1 – 10 of 60
ORMDL2
Tdark
Novelty: 1.15710653
p_int: 0.999610166
p_ni: 0.000389833
p_wrong: 1e-9
Score: 0.242
Data Source: BioPlex,STRINGDB
SFXN5
Tdark
Novelty: 0.44295302
p_int: 0.988350109
p_ni: 0.011649887
p_wrong: 4e-9
Data Source: BioPlex
SLC19A2
Tbio
Family: Transporter
Novelty: 0.01022325
p_int: 0.987496646
p_ni: 0.012503354
Score: 0.292
Data Source: BioPlex,STRINGDB
VSIG8
Tdark
Novelty: 1.45341615
p_int: 0.955569858
p_ni: 0.044420463
p_wrong: 0.000009679
Data Source: BioPlex
TUBB3
Tclin
Novelty: 0.00281462
p_int: 0.805205003
p_ni: 0.194794997
Data Source: BioPlex
ATL3
Tbio
Novelty: 0.07586934
p_int: 0.788843506
p_ni: 0.211150166
p_wrong: 0.000006327
Score: 0.175
Data Source: BioPlex,STRINGDB
CTU2
Tdark
Novelty: 0.0163545
p_int: 0.780552642
p_ni: 0.219447355
p_wrong: 3e-9
Score: 0.181
Data Source: BioPlex,STRINGDB
ARL5B
Tbio
Family: Enzyme
Novelty: 0.04765152
p_int: 0.768939878
p_ni: 0.231046242
p_wrong: 0.00001388
Score: 0.175
Data Source: BioPlex,STRINGDB
YIPF3
Tbio
Novelty: 0.03141831
p_int: 0.753410664
p_ni: 0.246589336
Data Source: BioPlex
TG
Tbio
Novelty: 0.00012413
Score: 0.828
Data Source: STRINGDB
Publication Statistics
PubMed Score  1101.32

PubMed score by year
PubTator Score  334.26

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEAVETGERPTFGAWDYGVFALMLLVSTGIGLWVGLARGGQRSAEDFFTGGRRLAALPVGLSLSASFMSA
1-70
VQVLGVPSEAYRYGLKFLWMCLGQLLNSVLTALLFMPVFYRLGLTSTYEYLEMRFSRAVRLCGTLQYIVA
70-140
TMLYTGIVIYAPALILNQVTGLDIWASLLSTGIICTFYTAVGGMKAVVWTDVFQVVVMLSGFWVVLARGV
140-210
MLVGGPRQVLTLAQNHSRINLMDFNPDPRSRYTFWTFVVGGTLVWLSMYGVNQAQVQRYVACRTEKQAKL
210-280
ALLINQVGLFLIVSSAACCGIVMFVFYTDCDPLLLGRISAPDQYMPLLVLDIFEDLPGVPGLFLACAYSG
280-350
TLSTASTSINAMAAVTVEDLIKPRLRSLAPRKLVIISKGLSLIYGSACLTVAALSSLLGGGVLQGSFTVM
350-420
GVISGPLLGAFILGMFLPACNTPGVLAGLGAGLALSLWVALGATLYPPSEQTMRVLPSSAARCVALSVNA
420-490
SGLLDPALLPANDSSRAPSSGMDASRPALADSFYAISYLYYGALGTLTTVLCGALISCLTGPTKRSTLAP
490-560
GLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCV
560-630
GHDGGRDQQETNL
630-643
MEAVETGERPTFGAWDYGVFALMLLVSTGIGLWVGLARGGQRSAEDFFTGGRRLAALPVGLSLSASFMSAVQVLGVPSEAYRYGLKFLWMCLGQLLNSVLTALLFMPVFYRLGLTSTYEYLEMRFSRAVRLCGTLQYIVATMLYTGIVIYAPALILNQVTGLDIWASLLSTGIICTFYTAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSRINLMDFNPDPRSRYTFWTFVVGGTLVWLSMYGVNQAQVQRYVACRTEKQAKLALLINQVGLFLIVSSAACCGIVMFVFYTDCDPLLLGRISAPDQYMPLLVLDIFEDLPGVPGLFLACAYSGTLSTASTSINAMAAVTVEDLIKPRLRSLAPRKLVIISKGLSLIYGSACLTVAALSSLLGGGVLQGSFTVMGVISGPLLGAFILGMFLPACNTPGVLAGLGAGLALSLWVALGATLYPPSEQTMRVLPSSAARCVALSVNASGLLDPALLPANDSSRAPSSGMDASRPALADSFYAISYLYYGALGTLTTVLCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL