You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
UFD1
Ubiquitin recognition factor in ER-associated degradation protein 1

Protein Summary
Description
Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. It may be involved in the development of some ectoderm-derived structures (By similarity). Acts as a negative regulator of type I interferon production via the complex formed with VCP and NPLOC4, which binds to DDX58/RIG-I and recruits RNF125 to promote ubiquitination and degradation of DDX58/RIG-I (PubMed:26471729). The protein encoded by this gene forms a complex with two other proteins, nuclear protein localization-4 and valosin-containing protein, and this complex is necessary for the degradation of ubiquitinated proteins. In ad ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263202
  • ENSP00000263202
  • ENSG00000070010
  • ENST00000399523
  • ENSP00000382439

Symbol
  • UFD1L
  • UFD1L
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 47.41   (req: < 5)
Gene RIFs: 20   (req: <= 3)
Antibodies: 286   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 47.41   (req: >= 5)
Gene RIFs: 20   (req: > 3)
Antibodies: 286   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (20)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (263)
1 – 10 of 263
SLC17A2
Tdark
Family: Transporter
Novelty: 0.66666667
p_int: 0.985086171
p_ni: 0.014913829
Score: 0.518
Data Source: BioPlex,STRINGDB
TMEM31
Tdark
Novelty: 0.66666667
p_int: 0.937488935
p_ni: 0.062511065
Data Source: BioPlex
SLC22A15
Tdark
Family: Transporter
Novelty: 0.8372093
p_int: 0.897527939
p_ni: 0.102472061
Data Source: BioPlex
SV2C
Tbio
Novelty: 0.03980733
p_int: 0.838851377
p_ni: 0.161148623
Score: 0.309
Data Source: BioPlex,STRINGDB
ATG9A
Tbio
Novelty: 0.02725439
p_int: 0.779226024
p_ni: 0.220773976
Score: 0.663
Data Source: BioPlex,STRINGDB
PTCHD3
Tbio
Novelty: 0.00118764
p_int: 0.765435299
p_ni: 0.234564701
Data Source: BioPlex
FAM189B
Tbio
Novelty: 0.62780269
p_int: 0.765394663
p_ni: 0.234605337
Data Source: BioPlex
NPLOC4
Tbio
Novelty: 0.02827204
Score: 0.999
Data Source: Reactome,STRINGDB
VCP
Tchem
Family: Enzyme
Novelty: 0.00103483
Score: 0.999
Data Source: Reactome,STRINGDB
UBXN7
Tbio
Novelty: 0.05830904
Score: 0.994
Data Source: STRINGDB
Publication Statistics
PubMed Score  47.41

PubMed score by year
PubTator Score  54.58

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLT
1-70
NKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKA
70-140
VLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERQVQHEEST
140-210
EGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKK
210-280
VEEDEAGGRFVAFSGEGQSLRKKGRKP
280-307
MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERQVQHEESTEGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFVAFSGEGQSLRKKGRKP