You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FRAT1
Proto-oncogene FRAT1

Protein Summary
Description
Positively regulates the Wnt signaling pathway by stabilizing beta-catenin through the association with GSK-3. May play a role in tumor progression and collaborate with PIM1 and MYC in lymphomagenesis. The protein encoded by this gene belongs to the GSK-3-binding protein family. The protein inhibits GSK-3-mediated phosphorylation of beta-catenin and positively regulates the Wnt signaling pathway. It may function in tumor progression and in lymphomagenesis. [provided by RefSeq, Oct 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000371021
  • ENSP00000360060
  • ENSG00000165879
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.9
PubMedID
0.7
gene perturbation
0.65
transcription factor
0.6
histone modification site profile
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.06   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 102   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.06   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 102   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (26)
Beta-catenin phosphorylation cascade (R-HSA-196299)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Beta-catenin phosphorylation cascade
Reactome
Degradation of beta-catenin by the destruction complex
Reactome
Disassembly of the destruction complex and recruitment of AXIN to the membrane
Reactome
Signal Transduction
Reactome
Signaling by WNT
Name
Explore in Pharos
Explore in Source
Beta-catenin phosphorylation cascade
Degradation of beta-catenin by the destruction complex
Disassembly of the destruction complex and recruitment of AXIN to the membrane
Signal Transduction
Signaling by WNT
Gene Ontology Terms (6)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
WormBase
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Protein-Protein Interactions (36)
1 – 10 of 36
GSK3A
Tclin
Family: Kinase
Novelty: 0.01538406
p_int: 0.859414764
p_ni: 1e-9
p_wrong: 0.140585235
Score: 0.895
Data Source: BioPlex,STRINGDB
GSK3B
Tclin
Family: Kinase
Novelty: 0.00104435
Score: 0.994
Data Source: Reactome,STRINGDB
AXIN1
Tbio
Novelty: 0.00280253
Score: 0.976
Data Source: STRINGDB
CTNNB1
Tchem
Novelty: 0.00008951
Score: 0.949
Data Source: STRINGDB
DVL1
Tchem
Novelty: 0.00460899
Score: 0.935
Data Source: STRINGDB
APC
Tbio
Novelty: 0.00224921
Score: 0.926
Data Source: STRINGDB
CSNK1A1
Tchem
Family: Kinase
Novelty: 0.01360707
Score: 0.919
Data Source: STRINGDB
PPP2R1A
Tbio
Family: Enzyme
Novelty: 0.01848436
Score: 0.909
Data Source: STRINGDB
PPP2R5C
Tbio
Family: Enzyme
Novelty: 0.03825051
Score: 0.907
Data Source: STRINGDB
AMER1
Tbio
Novelty: 0.00504407
Score: 0.903
Data Source: STRINGDB
Publication Statistics
PubMed Score  24.06

PubMed score by year
PubTator Score  19.37

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSPASPCGPPGAP
1-70
LRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGRVRGRAAPYCVAELATGPSAL
70-140
SPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASRRLQQRRGSQPETRTGDDDPHRLLQQLVLSG
140-210
NLIKEAVRRLHSRRLQLRAKLPQRPLLGPLSAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS
210-279
MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSPASPCGPPGAPLRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGRVRGRAAPYCVAELATGPSALSPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASRRLQQRRGSQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRAKLPQRPLLGPLSAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS