You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NECTIN2
Nectin-2

Protein Summary
Description
Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive (PubMed:26755705). Probable cell adhesion protein (PubMed:9657005). (Microbial infection) Acts as a receptor for herpes simplex virus 1 (HHV-1) mutant Rid1, herpes simplex virus 1 (HHV-2) and pseudorabies virus (PRV). This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with diff ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000252483
  • ENSP00000252483
  • ENSG00000130202
  • ENST00000252485
  • ENSP00000252485

Symbol
  • HVEB
  • PRR2
  • PVRL2
  • HVEB
  • PRR2
  • CD112
  • PVRL2
  • PVRR2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 77.92   (req: < 5)
Gene RIFs: 29   (req: <= 3)
Antibodies: 476   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 77.92   (req: >= 5)
Gene RIFs: 29   (req: > 3)
Antibodies: 476   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 28
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (166)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Adherens junctions interactions
Reactome
Cell junction organization
Reactome
Cell-Cell communication
Reactome
Cell-cell junction organization
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Adherens junctions interactions
Cell junction organization
Cell-Cell communication
Cell-cell junction organization
Protein-Protein Interactions (113)
1 – 10 of 113
TMEM30B
Tbio
Novelty: 0.41265163
p_int: 0.999949974
p_ni: 0.000050026
Data Source: BioPlex
NECTIN3
Tbio
Novelty: 0.02114497
p_int: 0.99437014
p_ni: 0.00562986
Score: 0.969
Data Source: BioPlex,Reactome,STRINGDB
RARS
Tchem
Family: Enzyme
Novelty: 0.00081224
p_int: 0.994315315
p_ni: 0.005684685
Data Source: BioPlex
SYPL2
Tdark
Novelty: 0.04422372
p_int: 0.973993129
p_ni: 0.026006871
Score: 0.163
Data Source: BioPlex,STRINGDB
BTBD1
Tbio
Novelty: 0.32684825
p_int: 0.916094556
p_ni: 0.083905433
p_wrong: 1.1e-8
Data Source: BioPlex
TBC1D22A
Tbio
Novelty: 0.42217484
p_int: 0.845577045
p_ni: 0.154422955
p_wrong: 1e-9
Score: 0.179
Data Source: BioPlex,STRINGDB
SERPINA12
Tbio
Novelty: 0.00636095
p_int: 0.841293379
p_ni: 0.158693734
p_wrong: 0.000012886
Data Source: BioPlex
NR2F6
Tbio
Family: NR
Novelty: 0.02380073
p_int: 0.820579509
p_ni: 0.179404843
p_wrong: 0.000015648
Data Source: BioPlex
PANK2
Tbio
Family: Kinase
Novelty: 0.00556645
p_int: 0.805291531
p_ni: 0.194708468
p_wrong: 1e-9
Score: 0.219
Data Source: BioPlex,STRINGDB
PICK1
Tbio
Novelty: 0.00686801
p_int: 0.804501895
p_ni: 0.195498105
Score: 0.399
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  77.92

PubMed score by year
PubTator Score  76.55

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTW
1-70
QRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTC
70-140
EFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVS
140-210
GTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDAT
210-280
LSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETP
280-350
NTAGAGATGGIIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM
350-420
PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPVPPGPPAVEDV
420-490
SLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV
490-538
MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGGIIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEMPSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPVPPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV