You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CENPI
Centromere protein I

Protein Summary
Description
Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex. Required for the localization of CENPF, MAD1L1 and MAD2 (MAD2L1 or MAD2L2) to kinetochores. Involved in the response of gonadal tissues to follicle-stimulating hormone. This gene encodes a centromere protein that is a component of the CENPA-NAC (nucleosome-associated) complex. This complex is critical for accurate chromosome alignment and segregation and it ensures proper mitotic progression. This protein regulates the recruitment of kinetochore-associated proteins that are required to generate the spindle checkpoint signal. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. Mutations in this gene may be involved in hum ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000372926
  • ENSP00000362017
  • ENSG00000102384
  • ENST00000372927
  • ENSP00000362018
  • ENST00000423383
  • ENSP00000399274

Symbol
  • FSHPRH1
  • ICEN19
  • LRPR1
  • LRPR1
  • CENP-I
  • FSHPRH1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.85
transcription factor perturbation
0.74
cellular component
0.67
histone modification site profile
0.5
pathway
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 41.25   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 147   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 41.25   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 147   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (19)
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal (R-HSA-141444)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 19
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Reactome
Amplification of signal from the kinetochores
Reactome
Cell Cycle
Reactome
Cell Cycle Checkpoints
Reactome
Cell Cycle, Mitotic
Name
Explore in Pharos
Explore in Source
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Amplification of signal from the kinetochores
Cell Cycle
Cell Cycle Checkpoints
Cell Cycle, Mitotic
Gene Ontology Terms (6)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
HPA
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (227)
1 – 10 of 227
RBM34
Tdark
Novelty: 1.05263158
p_int: 0.999795869
p_ni: 0.000204131
Score: 0.228
Data Source: BioPlex,STRINGDB
NIFK
Tbio
Novelty: 0.02038052
p_int: 0.999399137
p_ni: 0.000493671
p_wrong: 0.000107193
Score: 0.528
Data Source: BioPlex,STRINGDB
DGCR8
Tbio
Novelty: 0.00319395
p_int: 0.999246709
p_ni: 0.000753287
p_wrong: 4e-9
Score: 0.313
Data Source: BioPlex,STRINGDB
CENPU
Tbio
Novelty: 0.06760563
p_int: 0.99596167
p_ni: 0.003982227
p_wrong: 0.000056103
Score: 0.997
Data Source: BioPlex,STRINGDB
ZNF71
Tdark
Family: TF
Novelty: 0.25641026
p_int: 0.967208745
p_ni: 0.032759168
p_wrong: 0.000032088
Score: 0.544
Data Source: BioPlex,STRINGDB
CENPH
Tbio
Novelty: 0.03525011
Score: 0.997
Data Source: Reactome,STRINGDB
CENPO
Tbio
Novelty: 0.21171789
Score: 0.996
Data Source: STRINGDB
CENPP
Tbio
Novelty: 0.63556116
Score: 0.994
Data Source: STRINGDB
CENPK
Tbio
Novelty: 0.04916402
Score: 0.994
Data Source: Reactome,STRINGDB
ITGB3BP
Tbio
Novelty: 0.08545938
Score: 0.992
Data Source: STRINGDB
Publication Statistics
PubMed Score  41.25

PubMed score by year
PubTator Score  10.7

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPVGDYEHADDQAEEDALQMAV
1-70
GYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVNTRILKCMIPATVIS
70-140
EDSVVKAVSWLCVGKCSGSTKVLFYRWLVAMFDFIDRKEQINLLYGFFFASLQDDALCPYVCHLLYLLTK
140-210
KENVKPFRVRKLLDLQAKMGMQPHLQALLSLYKFFAPALISVSLPVRKKIYFKNSENLWKTALLAVKQRN
210-280
RGPSPEPLKLMLGPANVRPLKRKWNSLSVIPVLNSSSYTKECGKKEMSLSDCLNRSGSFPLEQLQSFPQL
280-350
LQNIHCLELPSQMGSVLNNSLLLHYINCVRDEPVLLRFYYWLSQTLQEECIWYKVNNYEHGKEFTNFLDT
350-420
IIRAECFLQEGFYSCEAFLYKSLPLWDGLCCRSQFLQLVSWIPFSSFSEVKPLLFDHLAQLFFTSTIYFK
420-490
CSVLQSLKELLQNWLLWLSMDIHMKPVTNSPLETTLGGSMNSVSKLIHYVGWLSTTAMRLESNNTFLLHF
490-560
ILDFYEKVCDIYINYNLPLVVLFPPGIFYSALLSLDTSILNQLCFIMHRYRKNLTAAKKNELVQKTKSEF
560-630
NFSSKTYQEFNHYLTSMVGCLWTSKPFGKGIYIDPEILEKTGVAEYKNSLNVVHHPSFLSYAVSFLLQES
630-700
PEERTVNVSSIRGKKWSWYLDYLFSQGLQGLKLFIRSSVHHSSIPRAEGINCNNQY
700-756
MSPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVNTRILKCMIPATVISEDSVVKAVSWLCVGKCSGSTKVLFYRWLVAMFDFIDRKEQINLLYGFFFASLQDDALCPYVCHLLYLLTKKENVKPFRVRKLLDLQAKMGMQPHLQALLSLYKFFAPALISVSLPVRKKIYFKNSENLWKTALLAVKQRNRGPSPEPLKLMLGPANVRPLKRKWNSLSVIPVLNSSSYTKECGKKEMSLSDCLNRSGSFPLEQLQSFPQLLQNIHCLELPSQMGSVLNNSLLLHYINCVRDEPVLLRFYYWLSQTLQEECIWYKVNNYEHGKEFTNFLDTIIRAECFLQEGFYSCEAFLYKSLPLWDGLCCRSQFLQLVSWIPFSSFSEVKPLLFDHLAQLFFTSTIYFKCSVLQSLKELLQNWLLWLSMDIHMKPVTNSPLETTLGGSMNSVSKLIHYVGWLSTTAMRLESNNTFLLHFILDFYEKVCDIYINYNLPLVVLFPPGIFYSALLSLDTSILNQLCFIMHRYRKNLTAAKKNELVQKTKSEFNFSSKTYQEFNHYLTSMVGCLWTSKPFGKGIYIDPEILEKTGVAEYKNSLNVVHHPSFLSYAVSFLLQESPEERTVNVSSIRGKKWSWYLDYLFSQGLQGLKLFIRSSVHHSSIPRAEGINCNNQY