You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PIK3R3
Phosphatidylinositol 3-kinase regulatory subunit gamma

Protein Summary
Description
Binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1. Phosphatidylinositol 3-kinase (PI3K) phosphorylates phosphatidylinositol and similar compounds, which then serve as second messengers in growth signaling pathways. PI3K is composed of a catalytic and a regulatory subunit. The protein encoded by this gene represents a regulatory subunit of PI3K. The encoded protein contains two SH2 domains through which it binds activated protein tyrosine kinases to regulate their activity. [provided by RefSeq, Jun 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262741
  • ENSP00000262741
  • ENSG00000117461
  • ENST00000372006
  • ENSP00000361075
  • ENST00000420542
  • ENSP00000412546
  • ENST00000423209
  • ENSP00000391431

Symbol
  • p55
  • p55PIK
  • p55-GAMMA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.96
gene perturbation
0.94
hub protein
0.92
pathway
0.91
PubMedID
0.82


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.7   (req: < 5)
Gene RIFs: 30   (req: <= 3)
Antibodies: 230   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.7   (req: >= 5)
Gene RIFs: 30   (req: > 3)
Antibodies: 230   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (176)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 40
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Axon guidance
Reactome
CD28 co-stimulation
Reactome
CD28 dependent PI3K/Akt signaling
Reactome
Constitutive Signaling by Aberrant PI3K in Cancer
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Axon guidance
CD28 co-stimulation
CD28 dependent PI3K/Akt signaling
Constitutive Signaling by Aberrant PI3K in Cancer
Protein-Protein Interactions (392)
1 – 10 of 392
IRS2
Tbio
Novelty: 0.00217941
p_int: 1
Score: 0.972
Data Source: BioPlex,STRINGDB
PIK3CD
Tclin
Family: Kinase
Novelty: 0.0044215
p_int: 0.999999995
p_ni: 3e-9
p_wrong: 1e-9
Score: 0.988
Data Source: BioPlex,Reactome,STRINGDB
PIK3CA
Tclin
Family: Kinase
Novelty: 0.00077082
p_int: 0.999991998
p_ni: 0.000008002
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
PIK3CB
Tchem
Family: Kinase
Novelty: 0.00458119
p_int: 0.999974586
p_ni: 0.000025414
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
EHD2
Tbio
Novelty: 0.02701513
p_int: 0.997509337
p_ni: 0.002490659
p_wrong: 4e-9
Score: 0.243
Data Source: BioPlex,STRINGDB
PIK3R2
Tbio
Family: Enzyme
Novelty: 0.01245674
p_int: 0.990984064
p_ni: 0.009015936
Score: 0.982
Data Source: BioPlex,STRINGDB
HAVCR2
Tbio
Novelty: 0.00217571
p_int: 0.958674123
p_ni: 0.041325877
Score: 0.361
Data Source: BioPlex,STRINGDB
NISCH
Tclin
Novelty: 0.0013605
p_int: 0.954706713
p_ni: 0.045293285
p_wrong: 2e-9
Score: 0.6
Data Source: BioPlex,STRINGDB
PIK3R1
Tchem
Family: Kinase
Novelty: 0.00286014
p_int: 0.94430652
p_ni: 0.05569348
Score: 0.982
Data Source: BioPlex,STRINGDB
ALDH3B1
Tbio
Family: Enzyme
Novelty: 0.05626574
p_int: 0.890413319
p_ni: 0.109586681
Data Source: BioPlex
Publication Statistics
PubMed Score  50.70

PubMed score by year
PubTator Score  51.81

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVPNGMKDSSVSLQDAEWYWGDI
1-70
SREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHY
70-140
HHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQ
140-210
MKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQD
210-280
LKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENL
280-350
PHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
350-420
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
420-461
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVPNGMKDSSVSLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR