You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IP6K1
Inositol hexakisphosphate kinase 1

Protein Classes
Protein Summary
Description
Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. This gene encodes a member of the inositol phosphokinase family. The encoded protein may be responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jun 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000321599
  • ENSP00000323780
  • ENSG00000176095
  • ENST00000395238
  • ENSP00000378659
  • ENST00000460540
  • ENSP00000420762
  • ENST00000613416
  • ENSP00000482032

Symbol
  • IHPK1
  • KIAA0263
  • PiUS
  • IHPK1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.96
histone modification site profile
0.85
kinase perturbation
0.84
transcription factor perturbation
0.84
microRNA
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.31   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 222   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.31   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 222   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Inositol phosphate metabolism (R-HSA-1483249)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Inositol phosphate metabolism
Reactome
Metabolism
Reactome
Synthesis of IPs in the nucleus
Reactome
Synthesis of pyrophosphates in the cytosol
Name
Explore in Pharos
Explore in Source
Inositol phosphate metabolism
Metabolism
Synthesis of IPs in the nucleus
Synthesis of pyrophosphates in the cytosol
Gene Ontology Terms (17)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (74)
1 – 10 of 74
TMEM134
Tdark
Novelty: 0.4
p_int: 0.99999999
p_ni: 9e-9
Data Source: BioPlex
UBXN4
Tdark
Novelty: 0.36923077
p_int: 0.999999986
p_ni: 1.4e-8
Score: 0.679
Data Source: BioPlex,STRINGDB
VSIG1
Tbio
Novelty: 0.21196064
p_int: 0.9999976
p_ni: 0.0000024
Data Source: BioPlex
FGFR2
Tclin
Family: Kinase
Novelty: 0.00077461
p_int: 0.999993228
p_ni: 0.000006772
Score: 0.23
Data Source: BioPlex,STRINGDB
TFCP2
Tbio
Family: TF
Novelty: 0.00326998
p_int: 0.999976692
p_ni: 0.000023308
Score: 0.188
Data Source: BioPlex,STRINGDB
DEFA5
Tbio
Novelty: 0.01045537
p_int: 0.999974782
p_ni: 0.000025218
Data Source: BioPlex
DEFA6
Tbio
Novelty: 0.04754312
p_int: 0.999922615
p_ni: 0.000077385
Score: 0.158
Data Source: BioPlex,STRINGDB
CLMP
Tbio
Novelty: 0.00465077
p_int: 0.998257197
p_ni: 0.001742756
p_wrong: 4.7e-8
Score: 0.228
Data Source: BioPlex,STRINGDB
GYPB
Tbio
Novelty: 0.00257625
p_int: 0.996789682
p_ni: 0.003196023
p_wrong: 0.000014296
Data Source: BioPlex
EIF1AD
Tdark
Novelty: 0.26086957
p_int: 0.996761236
p_ni: 0.003236435
p_wrong: 0.000002329
Data Source: BioPlex
Publication Statistics
PubMed Score  38.31

PubMed score by year
PubTator Score  29.29

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYESLPPEMKEFT
1-70
PEYKGVVSVCFEGDSDGYINLVAYPYVESETVEQDDTTEREQPRRKHSRRSLHRSGSGSDHKEEKASLSL
70-140
ETSESSQEAKSPKVELHSHSEVPFQMLDGNSGLSSEKISHNPWSLRCHKQQLSRMRSESKDRKLYKFLLL
140-210
ENVVHHFKYPCVLDLKMGTRQHGDDASAEKAARQMRKCEQSTSATLGVRVCGMQVYQLDTGHYLCRNKYY
210-280
GRGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYDGKECRAESCL
280-350
DRRSEMRLKHLDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDFAHSTFKGFRDDPTVHDGPDR
350-420
GYVFGLENLISIMEQMRDENQ
420-441
MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYESLPPEMKEFTPEYKGVVSVCFEGDSDGYINLVAYPYVESETVEQDDTTEREQPRRKHSRRSLHRSGSGSDHKEEKASLSLETSESSQEAKSPKVELHSHSEVPFQMLDGNSGLSSEKISHNPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEKAARQMRKCEQSTSATLGVRVCGMQVYQLDTGHYLCRNKYYGRGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYDGKECRAESCLDRRSEMRLKHLDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDFAHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDENQ