You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PIGB
GPI mannosyltransferase 3

Protein Summary
Description
Mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers the third alpha-1,2-mannose to Man2-GlcN-acyl-PI during GPI precursor assembly. This gene encodes a transmembrane protein that is located in the endoplasmic reticulum and is involved in GPI-anchor biosynthesis. The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene is thought to encode a member of a family of dolichol-phosphate-mannose (Dol-P-Man) dependent mannosyltransferases. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000164305
  • ENSP00000164305
  • ENSG00000069943

Symbol
  • PIG-B
  • GPI-MT-III
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
histone modification site profile
0.93
disease perturbation
0.74
metabolite
0.73
kinase perturbation
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.75   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 86   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.75   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 86   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Post-translational modification: synthesis of GPI-anchored proteins
Reactome
Post-translational protein modification
Reactome
Synthesis of glycosylphosphatidylinositol (GPI)
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Post-translational modification: synthesis of GPI-anchored proteins
Post-translational protein modification
Synthesis of glycosylphosphatidylinositol (GPI)
Protein-Protein Interactions (59)
1 – 10 of 59
TCTN2
Tdark
Novelty: 0.19568118
p_int: 0.999977147
p_ni: 0.000022846
p_wrong: 7e-9
Data Source: BioPlex
LRRC55
Tbio
Family: IC
Novelty: 0.37735849
p_int: 0.999942169
p_ni: 0.000051617
p_wrong: 0.000006214
Data Source: BioPlex
LRRC52
Tbio
Family: IC
Novelty: 0.4058938
p_int: 0.999927126
p_ni: 0.000067703
p_wrong: 0.000005171
Data Source: BioPlex
TMPRSS12
Tdark
Family: Enzyme
Novelty: 0.70588235
p_int: 0.999726155
p_ni: 0.000249378
p_wrong: 0.000024467
Score: 0.189
Data Source: BioPlex,STRINGDB
MPPE1
Tbio
Family: Enzyme
Novelty: 0.25531915
p_int: 0.999689441
p_ni: 0.000096685
p_wrong: 0.000213874
Score: 0.437
Data Source: BioPlex,STRINGDB
CHRNB4
Tclin
Family: IC
Novelty: 0.02388015
p_int: 0.999501968
p_ni: 0.000222773
p_wrong: 0.000275259
Data Source: BioPlex
GGT7
Tbio
Family: Enzyme
Novelty: 0.0180475
p_int: 0.997107927
p_ni: 0.000698382
p_wrong: 0.002193692
Score: 0.159
Data Source: BioPlex,STRINGDB
POMK
Tbio
Family: Kinase
Novelty: 0.1748393
p_int: 0.996784232
p_ni: 0.001417844
p_wrong: 0.001797925
Score: 0.213
Data Source: BioPlex,STRINGDB
FUT1
Tbio
Family: Enzyme
Novelty: 0.00748704
p_int: 0.906021547
p_ni: 0.000109299
p_wrong: 0.093869154
Score: 0.189
Data Source: BioPlex,STRINGDB
SLC3A2
Tbio
Family: Transporter
Novelty: 0.00258645
p_int: 0.879910894
p_ni: 0.000049239
p_wrong: 0.120039867
Data Source: BioPlex
Publication Statistics
PubMed Score  22.75

PubMed score by year
PubTator Score  3.78

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRRPLSKCGMEPGGGDASLTLHGLQNRSHGKIKLRKRKSTLYFNTQEKSARRRGDLLGENIYLLLFTIAL
1-70
RILNCFLVQTSFVPDEYWQSLEVSHHMVFNYGYLTWEWTERLRSYTYPLIFASIYKILHLLGKDSVQLLI
70-140
WIPRLAQALLSAVADVRLYSLMKQLENQEVARWVFFCQLCSWFTWYCCTRTLTNTMETVLTIIALFYYPL
140-210
EGSKSMNSVKYSSLVALAFIIRPTAVILWTPLLFRHFCQEPRKLDLILHHFLPVGFVTLSLSLMIDRIFF
210-280
GQWTLVQFNFLKFNVLQNWGTFYGSHPWHWYFSQGFPVILGTHLPFFIHGCYLAPKRYRILLVTVLWTLL
280-350
VYSMLSHKEFRFIYPVLPFCMVFCGYSLTHLKTWKKPALSFLFLSNLFLALYTGLVHQRGTLDVMSHIQK
350-420
VCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEADVFYLNPLNWLHREFHD
420-490
DASLPTHLITFSILEEEISAFLISSNYKRTAVFFHTHLPEGRIGSHIYVYERKLKGKFNMKMKF
490-554
MRRPLSKCGMEPGGGDASLTLHGLQNRSHGKIKLRKRKSTLYFNTQEKSARRRGDLLGENIYLLLFTIALRILNCFLVQTSFVPDEYWQSLEVSHHMVFNYGYLTWEWTERLRSYTYPLIFASIYKILHLLGKDSVQLLIWIPRLAQALLSAVADVRLYSLMKQLENQEVARWVFFCQLCSWFTWYCCTRTLTNTMETVLTIIALFYYPLEGSKSMNSVKYSSLVALAFIIRPTAVILWTPLLFRHFCQEPRKLDLILHHFLPVGFVTLSLSLMIDRIFFGQWTLVQFNFLKFNVLQNWGTFYGSHPWHWYFSQGFPVILGTHLPFFIHGCYLAPKRYRILLVTVLWTLLVYSMLSHKEFRFIYPVLPFCMVFCGYSLTHLKTWKKPALSFLFLSNLFLALYTGLVHQRGTLDVMSHIQKVCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEADVFYLNPLNWLHREFHDDASLPTHLITFSILEEEISAFLISSNYKRTAVFFHTHLPEGRIGSHIYVYERKLKGKFNMKMKF