You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC39A7
Zinc transporter SLC39A7

Protein Summary
Description
Zinc transporter, that transports Zn(2+) from the endoplasmic reticulum/Golgi apparatus to the cytosol. Transport is stimulated by growth factors, such as EGF, and Ca(2+), as well as by exogenous Zn(2+). The protein encoded by this gene transports zinc from the Golgi and endoplasmic reticulum to the cytoplasm. This transport may be important for activation of tyrosine kinases, some of which could be involved in cancer progression. Therefore, modulation of the encoded protein could be useful as a therapeutic agent against cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000374675
  • ENSP00000363807
  • ENSG00000112473
  • ENST00000374677
  • ENSP00000363809
  • ENST00000383213
  • ENSP00000372700
  • ENSG00000206288
  • ENST00000383214
  • ENSP00000372701
  • ENST00000416369
  • ENSP00000403583
  • ENSG00000229802
  • ENST00000418477
  • ENSP00000416439
  • ENSG00000226614
  • ENST00000423043
  • ENSP00000389623
  • ENST00000431735
  • ENSP00000410656
  • ENSG00000224399
  • ENST00000441854
  • ENSP00000391735
  • ENST00000441953
  • ENSP00000413027
  • ENST00000443773
  • ENSP00000407093
  • ENSG00000227402
  • ENST00000456261
  • ENSP00000414145

Symbol
  • HKE4
  • RING5
  • KE4
  • HKE4
  • ZIP7
  • RING5
  • H2-KE4
  • D6S115E
  • D6S2244E
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cellular component
0.64
small molecule perturbation
0.63
tissue sample
0.63
cell line
0.6
interacting protein
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.01   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 227   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.01   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 227   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
Metal ion SLC transporters (R-HSA-425410)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metal ion SLC transporters
Reactome
SLC-mediated transmembrane transport
Reactome
Transport of bile salts and organic acids, metal ions and amine compounds
Reactome
Transport of small molecules
Reactome
Zinc influx into cells by the SLC39 gene family
Name
Explore in Pharos
Explore in Source
Metal ion SLC transporters
SLC-mediated transmembrane transport
Transport of bile salts and organic acids, metal ions and amine compounds
Transport of small molecules
Zinc influx into cells by the SLC39 gene family
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (80)
1 – 10 of 80
SLC39A1
Tbio
Family: Transporter
Novelty: 0.01007486
Score: 0.903
Data Source: STRINGDB
SLC30A7
Tbio
Family: Transporter
Novelty: 0.04211849
Score: 0.889
Data Source: STRINGDB
SLC39A9
Tbio
Family: Transporter
Novelty: 0.0825498
Score: 0.884
Data Source: STRINGDB
SLC30A5
Tbio
Family: Transporter
Novelty: 0.03895139
Score: 0.875
Data Source: STRINGDB
SLC39A2
Tbio
Family: Transporter
Novelty: 0.02039876
Score: 0.875
Data Source: STRINGDB
SLC30A1
Tbio
Family: Transporter
Novelty: 0.00733144
Score: 0.85
Data Source: STRINGDB
SLC30A6
Tbio
Family: Transporter
Novelty: 0.09437965
Score: 0.842
Data Source: STRINGDB
HSD17B8
Tbio
Family: Enzyme
Novelty: 0.01566425
Score: 0.838
Data Source: STRINGDB
SLC30A10
Tbio
Family: Transporter
Novelty: 0.00699767
Score: 0.835
Data Source: STRINGDB
KIFC1
Tchem
Novelty: 0.00936802
Score: 0.816
Data Source: STRINGDB
Publication Statistics
PubMed Score  38.01

PubMed score by year
PubTator Score  21.29

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSHAHGHGHTHES
1-70
IWHGHTHDHDHGHSHEDLHHGHSHGYSHESLYHRGHGHDHEHSHGGYGESGAPGIKQDLDAVTLWAYALG
70-140
ATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGLLGDAFLHLIPHALEPHSHHTLEQPGHGHSH
140-210
SGQGPILSVGLWVLSGIVAFLVVEKFVRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEE
210-280
KETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGIL
280-350
TTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALLTEGGAVGSEIAGGAGPGWVL
350-420
PFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVIMMVLIAHLE
420-469
MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSHAHGHGHTHESIWHGHTHDHDHGHSHEDLHHGHSHGYSHESLYHRGHGHDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGLLGDAFLHLIPHALEPHSHHTLEQPGHGHSHSGQGPILSVGLWVLSGIVAFLVVEKFVRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALLTEGGAVGSEIAGGAGPGWVLPFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVIMMVLIAHLE