You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DNAJC9
DnaJ homolog subfamily C member 9

Protein Summary
Description
May play a role as co-chaperone of the Hsp70 family proteins HSPA1A, HSPA1B and HSPA8.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000372950
  • ENSP00000362041
  • ENSG00000213551

Symbol
  • JDD1
  • SB73
  • HDJC9
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.99
disease perturbation
0.98
transcription factor perturbation
0.91
co-expressed gene
0.89
transcription factor binding site profile
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.88   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 125   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.88   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 125   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (116)
1 – 10 of 116
FAM149B1
Tdark
Novelty: 0.9
Score: 0.937
Data Source: STRINGDB
RFC4
Tbio
Novelty: 0.05335859
Score: 0.881
Data Source: STRINGDB
DUT
Tchem
Family: Enzyme
Novelty: 0.003979
Score: 0.878
Data Source: STRINGDB
MCM2
Tbio
Novelty: 0.00349585
Score: 0.852
Data Source: STRINGDB
MSH2
Tbio
Novelty: 0.00062722
Score: 0.818
Data Source: STRINGDB
NASP
Tbio
Novelty: 0.01609866
Score: 0.802
Data Source: STRINGDB
SMC2
Tbio
Novelty: 0.13883394
Score: 0.794
Data Source: STRINGDB
MCM6
Tbio
Novelty: 0.0090985
Score: 0.791
Data Source: STRINGDB
FEN1
Tchem
Family: Enzyme
Novelty: 0.00147856
Score: 0.785
Data Source: STRINGDB
RRM1
Tclin
Family: Enzyme
Novelty: 0.00116467
Score: 0.772
Data Source: STRINGDB
Publication Statistics
PubMed Score  4.88

PubMed score by year
PubTator Score  4

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLS
1-70
DREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGD
70-140
MDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLD
140-210
EGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK
210-260
MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK