You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PIBF1
Progesterone-induced-blocking factor 1

Protein Summary
Description
Plays a role in ciliogenesis. Isoform 1: Pericentriolar protein required to maintain mitotic spindle pole integrity (PubMed:21224392). Required for the centrosomal accumulation of PCM1 and the recruitment of centriolar satellite proteins such as BBS4. Via association with PCM1 may be involved in primary cilia formation (PubMed:23110211). Required for CEP63 centrosomal localization and its interaction with WDR62. Together with CEP63 promotes centriole duplication. Promotes the centrosomal localization of CDK2 (PubMed:26297806). Isoform 4: The secreted form is a mediator of progesterone that by acting on the phospholipase A2 enzyme interferes with arachidonic acid metabolism, induces a Th2 biased immune response, and by controlling decidual naturakl killer cells (NK) activity exerts an anti-abortive effect (PubMed:14634107, PubMed:3863495, PubMed:12516630). Increases the production of Th2-type cytokines by signaling via the JAK/STAT pathway. Activates STAT6 and inhibits STAT4 phosphoryla ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000326291
  • ENSP00000317144
  • ENSG00000083535
  • ENST00000615625
  • ENSP00000483286

Symbol
  • C13orf24
  • PIBF
  • PIBF
  • CEP90
  • JBTS33
  • C13orf24
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.87
cell type or tissue
0.8
virus perturbation
0.72
transcription factor binding site profile
0.62
trait
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 25.36   (req: < 5)
Gene RIFs: 25   (req: <= 3)
Antibodies: 276   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 25.36   (req: >= 5)
Gene RIFs: 25   (req: > 3)
Antibodies: 276   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (19)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (59)
1 – 10 of 59
TSNAXIP1
Tdark
Novelty: 5
p_int: 0.999999556
p_ni: 4.44e-7
Score: 0.197
Data Source: BioPlex,STRINGDB
BFSP1
Tbio
Novelty: 0.00749498
p_int: 0.9999989
p_ni: 0.000001099
p_wrong: 1e-9
Data Source: BioPlex
VAT1L
Tdark
Family: Enzyme
Novelty: 1.09090909
p_int: 0.999996608
p_ni: 0.000003392
Score: 0.332
Data Source: BioPlex,STRINGDB
CPNE2
Tdark
Novelty: 0.33799663
p_int: 0.999989447
p_ni: 0.000010553
Data Source: BioPlex
LRRCC1
Tdark
Novelty: 0.16783217
p_int: 0.999701194
p_ni: 0.000298806
Score: 0.204
Data Source: BioPlex,STRINGDB
ODF2
Tbio
Novelty: 0.03275361
p_int: 0.998756687
p_ni: 0.001228866
p_wrong: 0.000014446
Data Source: BioPlex
EXOC3
Tbio
Novelty: 0.01423005
p_int: 0.998596421
p_ni: 0.001403579
Score: 0.185
Data Source: BioPlex,STRINGDB
TXLNA
Tbio
Novelty: 0.08198492
p_int: 0.99805012
p_ni: 0.001949747
p_wrong: 1.33e-7
Data Source: BioPlex
BORCS6
Tdark
Novelty: 0.68965517
p_int: 0.996451533
p_ni: 0.003548441
p_wrong: 2.6e-8
Data Source: BioPlex
SLC25A41
Tdark
Family: Transporter
Novelty: 2.02597403
p_int: 0.994316592
p_ni: 0.005683398
p_wrong: 1.1e-8
Data Source: BioPlex
Publication Statistics
PubMed Score  25.36

PubMed score by year
PubTator Score  64.42

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSRKISKESKKVNISSSLESEDISLETTVPTDDISSSEEREGKVRITRQLIERKELLHNIQLLKIELSQK
1-70
TMMIDNLKVDYLTKIEELEEKLNDALHQKQLLTLRLDNQLAFQQKDASKYQELMKQEMETILLRQKQLEE
70-140
TNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAE
140-210
ELSTNKNQLKQLTETYEEDRKNYSEVQIRCQRLALELADTKQLIQQGDYRQENYDKVKSERDALEQEVIE
210-280
LRRKHEILEASHMIQTKERSELSKEVVTLEQTVTLLQKDKEYLNRQNMELSVRCAHEEDRLERLQAQLEE
280-350
SKKAREEMYEKYVASRDHYKTEYENKLHDELEQIRLKTNQEIDQLRNASREMYERENRNLREARDNAVAE
350-420
KERAVMAEKDALEKHDQLLDRYRELQLSTESKVTEFLHQSKLKSFESERVQLLQEETARNLTQCQLECEK
420-490
YQKKLEVLTKEFYSLQASSEKRITELQAQNSEHQARLDIYEKLEKELDEIIMQTAEIENEDEAERVLFSY
490-560
GYGANVPTTAKRRLKQSVHLARRVLQLEKQNSLILKDLEHRKDQVTQLSQELDRANSLLNQTQQPYRYLI
560-630
ESVRQRDSKIDSLTESIAQLEKDVSNLNKEKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHS
630-700
ENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKMKT
700-757
MSRKISKESKKVNISSSLESEDISLETTVPTDDISSSEEREGKVRITRQLIERKELLHNIQLLKIELSQKTMMIDNLKVDYLTKIEELEEKLNDALHQKQLLTLRLDNQLAFQQKDASKYQELMKQEMETILLRQKQLEETNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAEELSTNKNQLKQLTETYEEDRKNYSEVQIRCQRLALELADTKQLIQQGDYRQENYDKVKSERDALEQEVIELRRKHEILEASHMIQTKERSELSKEVVTLEQTVTLLQKDKEYLNRQNMELSVRCAHEEDRLERLQAQLEESKKAREEMYEKYVASRDHYKTEYENKLHDELEQIRLKTNQEIDQLRNASREMYERENRNLREARDNAVAEKERAVMAEKDALEKHDQLLDRYRELQLSTESKVTEFLHQSKLKSFESERVQLLQEETARNLTQCQLECEKYQKKLEVLTKEFYSLQASSEKRITELQAQNSEHQARLDIYEKLEKELDEIIMQTAEIENEDEAERVLFSYGYGANVPTTAKRRLKQSVHLARRVLQLEKQNSLILKDLEHRKDQVTQLSQELDRANSLLNQTQQPYRYLIESVRQRDSKIDSLTESIAQLEKDVSNLNKEKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKMKT