You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
STON2
Stonin-2

Protein Summary
Description
Adapter protein involved in endocytic machinery. Involved in the synaptic vesicle recycling. May facilitate clathrin-coated vesicle uncoating. This gene encodes a protein which is a membrane protein involved in regulating endocytotic complexes. The protein product is described as one of the clathrin-associated sorting proteins, adaptor molecules which ensure specific proteins are internalized. The encoded protein has also been shown to participate in synaptic vesicle recycling through interaction with synaptotagmin 1 required for neurotransmission. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000267540
  • ENSP00000267540
  • ENSG00000140022
  • ENST00000555447
  • ENSP00000450857
  • ENST00000614646
  • ENSP00000477736

Symbol
  • STN2
  • STNB
  • STN2
  • STNB
  • STNB2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.9
cellular component
0.77
virus perturbation
0.76
cell line
0.66
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 31.54   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 19   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 31.54   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 19   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cargo recognition for clathrin-mediated endocytosis
Reactome
Clathrin-mediated endocytosis
Reactome
Membrane Trafficking
Reactome
Vesicle-mediated transport
Name
Explore in Pharos
Explore in Source
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Membrane Trafficking
Vesicle-mediated transport
Gene Ontology Terms (11)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (186)
1 – 10 of 186
AP2S1
Tbio
Novelty: 0.03619645
p_int: 0.99999997
p_ni: 2.6e-8
p_wrong: 4e-9
Score: 0.965
Data Source: BioPlex,STRINGDB
AP2M1
Tbio
Novelty: 0.01240983
p_int: 0.999999867
p_ni: 1.33e-7
Score: 0.966
Data Source: BioPlex,STRINGDB
EPS15L1
Tbio
Novelty: 0.08281964
p_int: 0.999999865
p_ni: 1.35e-7
Score: 0.983
Data Source: BioPlex,STRINGDB
LSR
Tbio
Novelty: 0.0032892
p_int: 0.999990119
p_ni: 0.000009878
p_wrong: 3e-9
Score: 0.157
Data Source: BioPlex,STRINGDB
CLINT1
Tbio
Novelty: 0.00532807
p_int: 0.999901492
p_ni: 0.000098369
p_wrong: 1.39e-7
Score: 0.718
Data Source: BioPlex,STRINGDB
SLC25A41
Tdark
Family: Transporter
Novelty: 2.02597403
p_int: 0.998111089
p_ni: 0.000322264
p_wrong: 0.001566647
Score: 0.528
Data Source: BioPlex,STRINGDB
CCDC32
Tdark
Novelty: 4
p_int: 0.98878603
p_ni: 0.001657952
p_wrong: 0.009556018
Data Source: BioPlex
EPS15
Tbio
Novelty: 0.00518368
Score: 0.995
Data Source: STRINGDB
SYT1
Tbio
Novelty: 0.00202951
Score: 0.992
Data Source: Reactome,STRINGDB
SYT2
Tbio
Novelty: 0.01076581
Score: 0.983
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  31.54

PubMed score by year
PubTator Score  16.78

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTTLDHVIATHQSEWVSFNEEPPFPAHSQGGTEEHLPGLSSSPDQSESSSGENHVVDGGSQDHSHSEQDD
1-70
SSEKMGLISEAASPPGSPEQPPPDLASAISNWVQFEDDTPWASTSPPHQETAETALPLTMPCWTCPSFDS
70-140
LGRCPLTSESSWTTHSEDTSSPSFGCSYTDLQLINAEEQTSGQASGADSTDNSSSLQEDEEVEMEAISWQ
140-210
ASSPAMNGHPAPPVTSARFPSWVTFDDNEVSCPLPPVTSPLKPNTPPSASVIPDVPYNSMGSFKKRDRPK
210-280
STLMNFSKVQKLDISSLNRTPSVTEASPWRATNPFLNETLQDVQPSPINPFSAFFEEQERRSQNSSISST
280-350
TGKSQRDSLIVIYQDAISFDDSSKTQSHSDAVEKLKQLQIDDPDHFGSATLPDDDPVAWIELDAHPPGSA
350-420
RSQPRDGWPMMLRIPEKKNIMSSRHWGPIFVKLTDTGYLQLYYEQGLEKPFREFKLEICHEISEPRLQNY
420-490
DENGRIHSLRIDRVTYKEKKKYQPKPAVAHTAEREQVIKLGTTNYDDFLSFIHAVQDRLMDLPVLSMDLS
490-560
TVGLNYLEEEITVDVRDEFSGIVSKGDNQILQHHVLTRIHILSFLSGLAECRLGLNDILVKGNEIVLRQD
560-630
IMPTTTTKWIKLHECRFHGCVDEDVFHNSRVILFNPLDACRFELMRFRTVFAEKTLPFTLRTATSVNGAE
630-700
VEVQSWLRMSTGFSANRDPLTQVPCENVMIRYPVPSEWVKNFRRESVLGEKSLKAKVNRGASFGSTSVSG
700-770
SEPVMRVTLGTAKYEHAFNSIVWRINRLPDKNSASGHPHCFFCHLELGSDREVPSRFANHVNVEFSMPTT
770-840
SASKASVRSISVEDKTDVRKWVNYSAHYSYQVALGSIWLMLPTPFVHPTTLPLLFLLAMLTMFAW
840-905
MTTLDHVIATHQSEWVSFNEEPPFPAHSQGGTEEHLPGLSSSPDQSESSSGENHVVDGGSQDHSHSEQDDSSEKMGLISEAASPPGSPEQPPPDLASAISNWVQFEDDTPWASTSPPHQETAETALPLTMPCWTCPSFDSLGRCPLTSESSWTTHSEDTSSPSFGCSYTDLQLINAEEQTSGQASGADSTDNSSSLQEDEEVEMEAISWQASSPAMNGHPAPPVTSARFPSWVTFDDNEVSCPLPPVTSPLKPNTPPSASVIPDVPYNSMGSFKKRDRPKSTLMNFSKVQKLDISSLNRTPSVTEASPWRATNPFLNETLQDVQPSPINPFSAFFEEQERRSQNSSISSTTGKSQRDSLIVIYQDAISFDDSSKTQSHSDAVEKLKQLQIDDPDHFGSATLPDDDPVAWIELDAHPPGSARSQPRDGWPMMLRIPEKKNIMSSRHWGPIFVKLTDTGYLQLYYEQGLEKPFREFKLEICHEISEPRLQNYDENGRIHSLRIDRVTYKEKKKYQPKPAVAHTAEREQVIKLGTTNYDDFLSFIHAVQDRLMDLPVLSMDLSTVGLNYLEEEITVDVRDEFSGIVSKGDNQILQHHVLTRIHILSFLSGLAECRLGLNDILVKGNEIVLRQDIMPTTTTKWIKLHECRFHGCVDEDVFHNSRVILFNPLDACRFELMRFRTVFAEKTLPFTLRTATSVNGAEVEVQSWLRMSTGFSANRDPLTQVPCENVMIRYPVPSEWVKNFRRESVLGEKSLKAKVNRGASFGSTSVSGSEPVMRVTLGTAKYEHAFNSIVWRINRLPDKNSASGHPHCFFCHLELGSDREVPSRFANHVNVEFSMPTTSASKASVRSISVEDKTDVRKWVNYSAHYSYQVALGSIWLMLPTPFVHPTTLPLLFLLAMLTMFAW