You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
HTR3C
5-hydroxytryptamine receptor 3C

Protein Summary
Description
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel. The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit C of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000318351
  • ENSP00000322617
  • ENSG00000178084
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.76
protein domain
0.73
cell line
0.53
tissue sample
0.42
phenotype
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.5   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 90   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.5   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 90   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Pathways (5)
Neuronal System (R-HSA-112316)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Neuronal System
Reactome
Neurotransmitter receptors and postsynaptic signal transmission
Reactome
Transmission across Chemical Synapses
Name
Explore in Pharos
Explore in Source
Neuronal System
Neurotransmitter receptors and postsynaptic signal transmission
Transmission across Chemical Synapses
Protein-Protein Interactions (51)
1 – 10 of 51
ABHD16A
Tchem
Family: Enzyme
Novelty: 0.01847741
p_int: 0.999981188
p_ni: 0.000013957
p_wrong: 0.000004855
Score: 0.196
Data Source: BioPlex,STRINGDB
UGT3A2
Tbio
Family: Enzyme
Novelty: 1.37837838
p_int: 0.999883699
p_ni: 0.000090466
p_wrong: 0.000025835
Data Source: BioPlex
SEC11C
Tdark
Family: Enzyme
Novelty: 0.24793388
p_int: 0.999843318
p_ni: 0.000153359
p_wrong: 0.000003323
Score: 0.205
Data Source: BioPlex,STRINGDB
ARHGAP8
Tbio
Family: Enzyme
Novelty: 0.33816845
p_int: 0.999829101
p_ni: 1e-9
p_wrong: 0.000170898
Data Source: BioPlex
TPST2
Tbio
Family: Enzyme
Novelty: 0.03075981
p_int: 0.99963561
p_ni: 0.000364389
p_wrong: 1e-9
Data Source: BioPlex
TUSC3
Tbio
Novelty: 0.01081706
p_int: 0.999297329
p_ni: 0.000702671
Data Source: BioPlex
TMEM186
Tdark
Novelty: 3
p_int: 0.998720053
p_ni: 0.001279946
Data Source: BioPlex
TMTC3
Tdark
Novelty: 0.4398827
p_int: 0.998493784
p_ni: 0.001506216
Score: 0.498
Data Source: BioPlex,STRINGDB
SPPL2B
Tbio
Family: Enzyme
Novelty: 0.03749833
p_int: 0.99711265
p_ni: 0.00288735
Data Source: BioPlex
TMEM104
Tdark
p_int: 0.99577699
p_ni: 0.003374161
p_wrong: 0.000848849
Score: 0.188
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  5.50

PubMed score by year
PubTator Score  8.17

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEGGWPARQSALLCLTVSLLLQGRGDAFTINCSGFDQHGVDPAVFQAVFDRKAFRPFTNYSIPTRVNISF
1-70
TLSAILGVDAQLQLLTSFLWMDLVWDNPFINWNPKECVGINKLTVLAENLWLPDIFIVESMDVDQTPSGL
70-140
TAYISSEGRIKYDKPMRVTSICNLDIFYFPFDQQNCTFTFSSFLYTVDSMLLGMDKEVWEITDTSRKVIQ
140-210
TQGEWELLGINKATPKMSMGNNLYDQIMFYVAIRRRPSLYIINLLVPSSFLVAIDALSFYLPAESENRAP
210-280
FKITLLLGYNVFLLMMNDLLPASGTPLISVYFALCLSLMVVSLLETVFITYLLHVATTQPPPMPRWLHSL
280-350
LLHCTSPGRCCPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKTQLMELWVQFSH
350-420
AMDTLLFRLYLLFMASSILTVIVLWNT
420-447
MEGGWPARQSALLCLTVSLLLQGRGDAFTINCSGFDQHGVDPAVFQAVFDRKAFRPFTNYSIPTRVNISFTLSAILGVDAQLQLLTSFLWMDLVWDNPFINWNPKECVGINKLTVLAENLWLPDIFIVESMDVDQTPSGLTAYISSEGRIKYDKPMRVTSICNLDIFYFPFDQQNCTFTFSSFLYTVDSMLLGMDKEVWEITDTSRKVIQTQGEWELLGINKATPKMSMGNNLYDQIMFYVAIRRRPSLYIINLLVPSSFLVAIDALSFYLPAESENRAPFKITLLLGYNVFLLMMNDLLPASGTPLISVYFALCLSLMVVSLLETVFITYLLHVATTQPPPMPRWLHSLLLHCTSPGRCCPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKTQLMELWVQFSHAMDTLLFRLYLLFMASSILTVIVLWNT