You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HPSE2
Inactive heparanase-2

Protein Summary
Description
Binds heparin and heparan sulfate with high affinity, but lacks heparanase activity. Inhibits HPSE, possibly by competing for its substrates (in vitro). This gene encodes a heparanase enzyme. The encoded protein is a endoglycosidase that degrades heparin sulfate proteoglycans located on the extracellular matrix and cell surface. This protein may be involved in biological processes involving remodeling of the extracellular matrix including angiogenesis and tumor progression. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000370546
  • ENSP00000359577
  • ENSG00000172987
  • ENST00000370549
  • ENSP00000359580
  • ENST00000370552
  • ENSP00000359583
  • ENST00000628193
  • ENSP00000485916

Symbol
  • HPA2
  • UFS
  • HPA2
  • HPR2
  • UFS1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.7
pathway
0.68
disease
0.61
trait
0.61
transcription factor
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 368.65   (req: < 5)
Gene RIFs: 26   (req: <= 3)
Antibodies: 166   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 368.65   (req: >= 5)
Gene RIFs: 26   (req: > 3)
Antibodies: 166   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (8)
Glycosaminoglycan metabolism (R-HSA-1630316)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Glycosaminoglycan metabolism
Reactome
HS-GAG degradation
Reactome
Heparan sulfate/heparin (HS-GAG) metabolism
Reactome
Metabolism
Reactome
Metabolism of carbohydrates
Name
Explore in Pharos
Explore in Source
Glycosaminoglycan metabolism
HS-GAG degradation
Heparan sulfate/heparin (HS-GAG) metabolism
Metabolism
Metabolism of carbohydrates
Protein-Protein Interactions (63)
1 – 10 of 63
ANKHD1
Tbio
Novelty: 0.08323329
p_int: 0.999997147
p_ni: 0.000002853
Data Source: BioPlex
ANKRD17
Tbio
Novelty: 0.05032241
p_int: 0.999396807
p_ni: 0.000603193
Data Source: BioPlex
DCAF1
Tbio
Novelty: 0.02016476
p_int: 0.998460554
p_ni: 0.001539446
Data Source: BioPlex
PEX6
Tbio
Family: Enzyme
Novelty: 0.01134558
p_int: 0.997835226
p_ni: 0.002128291
p_wrong: 0.000036482
Data Source: BioPlex
TIMM10B
Tdark
Family: Enzyme
Novelty: 0.92307692
p_int: 0.99655752
p_ni: 0.003436323
p_wrong: 0.000006158
Data Source: BioPlex
TARBP2
Tbio
Novelty: 0.01962451
p_int: 0.993215377
p_ni: 0.006784622
p_wrong: 1e-9
Data Source: BioPlex
RNF13
Tbio
Family: Enzyme
Novelty: 0.12485137
p_int: 0.992601695
p_ni: 0.004843304
p_wrong: 0.002555002
Data Source: BioPlex
NAF1
Tbio
p_int: 0.991558777
p_ni: 0.002884345
p_wrong: 0.005556878
Data Source: BioPlex
PPP1R15B
Tbio
Family: Enzyme
Novelty: 0.03268691
p_int: 0.990264333
p_ni: 0.006983879
p_wrong: 0.002751789
Data Source: BioPlex
CENPB
Tbio
Novelty: 0.00463672
p_int: 0.984725325
p_ni: 0.015274674
p_wrong: 1e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  368.65

PubMed score by year
PubTator Score  90.84

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRVLCAFPEAMPSSNSRPPACLAPGALYLALLLHLSLSSQAGDRRPLPVDRAAGLKEKTLILLDVSTKNP
1-70
VRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGP
70-140
DYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKEQFSNTYSNLILTARSLDKL
140-210
YNFADCSGLHLIFALNALRRNPNNSWNSSSALSLLKYSASKKYNISWELGNEPNNYRTMHGRAVNGSQLG
210-280
KDYIQLKSLLQPIRIYSRASLYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLK
280-350
TRLLDTLSDQIRKIQKVVNTYTPGKKIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLGMLANQGIDVVIR
350-420
HSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKLRIYAHCTNHHNH
420-490
NYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLKSKSVQLNGQPLVMVDDGTLPELKP
490-560
RPLRAGRTLVIPPVTMGFYVVKNVNALACRYR
560-592
MRVLCAFPEAMPSSNSRPPACLAPGALYLALLLHLSLSSQAGDRRPLPVDRAAGLKEKTLILLDVSTKNPVRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKEQFSNTYSNLILTARSLDKLYNFADCSGLHLIFALNALRRNPNNSWNSSSALSLLKYSASKKYNISWELGNEPNNYRTMHGRAVNGSQLGKDYIQLKSLLQPIRIYSRASLYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLKTRLLDTLSDQIRKIQKVVNTYTPGKKIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLGMLANQGIDVVIRHSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKLRIYAHCTNHHNHNYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLKSKSVQLNGQPLVMVDDGTLPELKPRPLRAGRTLVIPPVTMGFYVVKNVNALACRYR