You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC44A1
Choline transporter-like protein 1

Protein Summary
Description
Choline transporter. May be involved in membrane synthesis and myelin production.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000374720
  • ENSP00000363852
  • ENSG00000070214
  • ENST00000374723
  • ENSP00000363855
  • ENST00000374724
  • ENSP00000363856
  • ENST00000470972
  • ENSP00000433072

Symbol
  • CD92
  • CDW92
  • CTL1
  • CD92
  • CTL1
  • CDW92
  • CHTL1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.99
transcription factor binding site profile
0.97
small molecule perturbation
0.95
virus perturbation
0.95
PubMedID
0.9


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 49.75   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 268   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 49.75   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 268   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (11)
Choline catabolism (R-HSA-6798163)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Choline catabolism
Reactome
Glycerophospholipid biosynthesis
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Reactome
Metabolism of lipids
Name
Explore in Pharos
Explore in Source
Choline catabolism
Glycerophospholipid biosynthesis
Metabolism
Metabolism of amino acids and derivatives
Metabolism of lipids
Gene Ontology Terms (12)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
UniProtKB
Protein-Protein Interactions (41)
1 – 10 of 41
UPK1A
Tbio
Novelty: 0.02382993
p_int: 0.999976264
p_ni: 0.000023686
p_wrong: 5.1e-8
Data Source: BioPlex
TSPAN17
Tdark
Novelty: 0.52282158
p_int: 0.999969471
p_ni: 0.000030178
p_wrong: 3.5e-7
Score: 0.196
Data Source: BioPlex,STRINGDB
TNFRSF10C
Tbio
Novelty: 0.00061543
p_int: 0.999953664
p_ni: 0.0000166
p_wrong: 0.000029736
Data Source: BioPlex
NT5E
Tchem
Family: Enzyme
Novelty: 0.00121213
p_int: 0.999952733
p_ni: 0.000047266
p_wrong: 1e-9
Data Source: BioPlex
TMEM128
Tdark
p_int: 0.99995118
p_ni: 0.000036385
p_wrong: 0.000012435
Score: 0.165
Data Source: BioPlex,STRINGDB
TMEM159
Tdark
Novelty: 0.36363636
p_int: 0.99963129
p_ni: 0.000349774
p_wrong: 0.000018936
Data Source: BioPlex
PSCA
Tbio
Novelty: 0.00370639
p_int: 0.999604477
p_ni: 0.000384292
p_wrong: 0.000011231
Data Source: BioPlex
PTH1R
Tclin
Family: GPCR
Novelty: 0.0018948
p_int: 0.999412085
p_ni: 0.000360762
p_wrong: 0.000227153
Score: 0.183
Data Source: BioPlex,STRINGDB
LYPD3
Tbio
Novelty: 0.0363726
p_int: 0.999308263
p_ni: 0.000395681
p_wrong: 0.000296056
Data Source: BioPlex
LRRC55
Tbio
Family: IC
Novelty: 0.37735849
p_int: 0.998326878
p_ni: 0.001111002
p_wrong: 0.000562121
Data Source: BioPlex
Publication Statistics
PubMed Score  49.75

PubMed score by year
PubTator Score  39.59

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGCCSSASSAAQSSKREWKPLEDRSCTDIPWLLLFILFCIGMGFICGFSIATGAAARLVSGYDSYGNICG
1-70
QKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALC
70-140
SYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISCYAKFAEALITFVSDNSVLHRLISGVMT
140-210
SKEIILGLCLLSLVLSMILMVIIRYISRVLVWILTILVILGSLGGTGVLWWLYAKQRRSPKETVTPEQLQ
210-280
IAEDNLRALLIYAISATVFTVILFLIMLVMRKRVALTIALFHVAGKVFIHLPLLVFQPFWTFFALVLFWV
280-350
YWIMTLLFLGTTGSPVQNEQGFVEFKISGPLQYMWWYHVVGLIWISEFILACQQMTVAGAVVTYYFTRDK
350-420
RNLPFTPILASVNRLIRYHLGTVAKGSFIITLVKIPRMILMYIHSQLKGKENACARCVLKSCICCLWCLE
420-490
KCLNYLNQNAYTATAINSTNFCTSAKDAFVILVENALRVATINTVGDFMLFLGKVLIVCSTGLAGIMLLN
490-560
YQQDYTVWVLPLIIVCLFAFLVAHCFLSIYEMVVDVLFLCFAIDTKYNDGSPGREFYMDKVLMEFVENSR
560-630
KAMKEAGKGGVADSRELKPMASGASSA
630-657
MGCCSSASSAAQSSKREWKPLEDRSCTDIPWLLLFILFCIGMGFICGFSIATGAAARLVSGYDSYGNICGQKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISCYAKFAEALITFVSDNSVLHRLISGVMTSKEIILGLCLLSLVLSMILMVIIRYISRVLVWILTILVILGSLGGTGVLWWLYAKQRRSPKETVTPEQLQIAEDNLRALLIYAISATVFTVILFLIMLVMRKRVALTIALFHVAGKVFIHLPLLVFQPFWTFFALVLFWVYWIMTLLFLGTTGSPVQNEQGFVEFKISGPLQYMWWYHVVGLIWISEFILACQQMTVAGAVVTYYFTRDKRNLPFTPILASVNRLIRYHLGTVAKGSFIITLVKIPRMILMYIHSQLKGKENACARCVLKSCICCLWCLEKCLNYLNQNAYTATAINSTNFCTSAKDAFVILVENALRVATINTVGDFMLFLGKVLIVCSTGLAGIMLLNYQQDYTVWVLPLIIVCLFAFLVAHCFLSIYEMVVDVLFLCFAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADSRELKPMASGASSA