You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
APOBEC4
Putative C->U-editing enzyme APOBEC-4

Protein Summary
Description
Putative C to U editing enzyme whose physiological substrate is not yet known. This gene encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin genes, and innate immunity to retroviral infection. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000308641
  • ENSP00000310622
  • ENSG00000173627

Symbol
  • C1orf169
  • C1orf169
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.85
microRNA
0.51
disease
0.46
cell line
0.43
kinase perturbation
0.42


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.22   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 227   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.22   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 227   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Formation of the Editosome (R-HSA-75094)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Formation of the Editosome
Reactome
Metabolism of RNA
Reactome
mRNA Editing
Reactome
mRNA Editing: C to U Conversion
Name
Explore in Pharos
Explore in Source
Formation of the Editosome
Metabolism of RNA
mRNA Editing
mRNA Editing: C to U Conversion
Protein-Protein Interactions (30)
1 – 10 of 30
APOBEC2
Tbio
Novelty: 0.0532436
Score: 0.99
Data Source: STRINGDB
APOBEC1
Tbio
Novelty: 0.00924384
Score: 0.987
Data Source: STRINGDB
APOBEC3C
Tbio
Novelty: 0.01504935
Score: 0.978
Data Source: STRINGDB
APOBEC3B
Tbio
Novelty: 0.00941533
Score: 0.977
Data Source: STRINGDB
APOBEC3A
Tbio
Novelty: 0.01218142
Score: 0.977
Data Source: STRINGDB
APOBEC3H
Tbio
Novelty: 0.02300833
Score: 0.977
Data Source: STRINGDB
A1CF
Tbio
Novelty: 0.01084046
Score: 0.947
Data Source: STRINGDB
APOBEC3G
Tbio
Novelty: 0.0016311
Score: 0.807
Data Source: STRINGDB
APOBEC3F
Tbio
Novelty: 0.00975508
Score: 0.804
Data Source: STRINGDB
APOBEC3D
Tbio
Novelty: 0.02451843
Score: 0.782
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.22

PubMed score by year
PubTator Score  1.06

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEPIYEEYLANHGTIVKPYYWLSFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTFPQTKHLTFYE
1-70
LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNSPCNEANHCCISKMYN
70-140
FLITYPGITLSIYFSQLYHTEMDFPASAWNREALRSLASLWPRVVLSPISGGIWHSVLHSFISGVSGSHV
140-210
FQPILTGRALADRHNAYEINAITGVKPYFTDVLLQTKRNPNTKAQEALESYPLNNAFPGQFFQMPSGQLQ
210-280
PNLPPDLRAPVVFVLVPLRDLPPMHMGQNPNKPRNIVRHLNMPQMSFQETKDLGRLPTGRSVEIVEITEQ
280-350
FASSKEADEKKKKKGKK
350-367
MEPIYEEYLANHGTIVKPYYWLSFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTFPQTKHLTFYELKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNSPCNEANHCCISKMYNFLITYPGITLSIYFSQLYHTEMDFPASAWNREALRSLASLWPRVVLSPISGGIWHSVLHSFISGVSGSHVFQPILTGRALADRHNAYEINAITGVKPYFTDVLLQTKRNPNTKAQEALESYPLNNAFPGQFFQMPSGQLQPNLPPDLRAPVVFVLVPLRDLPPMHMGQNPNKPRNIVRHLNMPQMSFQETKDLGRLPTGRSVEIVEITEQFASSKEADEKKKKKGKK