You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SKA2
Spindle and kinetochore-associated protein 2

Protein Summary
Description
Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation (PubMed:17093495, PubMed:19289083, PubMed:23085020). Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint (PubMed:17093495). The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies (PubMed:19289083). The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner (PubMed:17093495, PubMed:19289083). In the complex, it is required for SKA1 localization (PubMed:19289083). Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules (PubMed:23085020).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000330137
  • ENSP00000333433
  • ENSG00000182628
  • ENST00000437036
  • ENSP00000411231

Symbol
  • FAM33A
  • FAM33A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.98
kinase perturbation
0.95
transcription factor binding site profile
0.84
transcription factor perturbation
0.84
transcription factor
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 20.02   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 126   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 20.02   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 126   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (16)
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal (R-HSA-141444)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Reactome
Amplification of signal from the kinetochores
Reactome
Cell Cycle
Reactome
Cell Cycle Checkpoints
Reactome
Cell Cycle, Mitotic
Name
Explore in Pharos
Explore in Source
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Amplification of signal from the kinetochores
Cell Cycle
Cell Cycle Checkpoints
Cell Cycle, Mitotic
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (143)
1 – 10 of 143
SKA3
Tbio
Novelty: 0.08112545
p_int: 0.999999868
p_ni: 1.8e-8
p_wrong: 1.14e-7
Score: 0.998
Data Source: BioPlex,STRINGDB
HAUS1
Tbio
Novelty: 0.04680423
p_int: 0.999987847
p_ni: 0.000012147
p_wrong: 6e-9
Score: 0.292
Data Source: BioPlex,STRINGDB
RALYL
Tdark
Novelty: 0.53215078
p_int: 0.997070609
p_ni: 0.000013787
p_wrong: 0.002915604
Score: 0.288
Data Source: BioPlex,STRINGDB
SKA1
Tbio
Novelty: 0.02651071
Score: 0.998
Data Source: STRINGDB
SPC24
Tbio
Novelty: 0.05521775
Score: 0.973
Data Source: STRINGDB
NDC80
Tbio
Novelty: 0.00334097
Score: 0.964
Data Source: STRINGDB
DSN1
Tbio
Novelty: 0.08344924
Score: 0.963
Data Source: STRINGDB
NUF2
Tbio
Novelty: 0.01790947
Score: 0.96
Data Source: STRINGDB
KNL1
Tbio
Novelty: 0.00616496
Score: 0.955
Data Source: STRINGDB
SGO1
Tbio
Novelty: 0.00311495
Score: 0.953
Data Source: STRINGDB
Publication Statistics
PubMed Score  20.02

PubMed score by year
PubTator Score  19.3

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKSRYQTLYARFKPVAVE
1-70
QKESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL
70-121
MEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKSRYQTLYARFKPVAVEQKESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL