You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
AFG1L
AFG1-like ATPase

Protein Summary
Description
Putative mitochondrial ATPase. Plays a role in mitochondrial morphology and mitochondrial protein metabolism. Promotes degradation of excess nuclear-encoded complex IV subunits (COX4I1, COX5A and COX6A1) and normal activity of complexes III and IV of the respiratory chain (PubMed:26759378, PubMed:27323408). Mediates mitochondrial translocation of TP53 and its transcription-independent apoptosis in response to genotoxic stress (PubMed:27323408). This gene encodes a mitochondrial integral membrane protein that plays a role in mitochondrial protein homeostasis. The protein contains a P-loop motif and a five-domain structure that is conserved in fly, yeast, and bacteria. It functions to mediate the degradation of nuclear-encoded complex IV subunits. Two conserved estrogen receptor binding sites are located within 2.5 kb of this gene. Polymorphisms in this gene have been associated with bipolar disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368977
  • ENSP00000357973
  • ENSG00000135537

Symbol
  • AFG1
  • LACE1
  • AFG1
  • LACE1
  • c222389
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 123.03   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 164   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 123.03   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 164   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (8)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (24)
1 – 10 of 24
SPATA5
Tbio
Family: Enzyme
Novelty: 0.00598222
Score: 0.967
Data Source: STRINGDB
ZAN
Tbio
Novelty: 0.01148836
Score: 0.71
Data Source: STRINGDB
CMTR2
Tbio
Family: Enzyme
Novelty: 0.00154741
Score: 0.702
Data Source: STRINGDB
TARBP2
Tbio
Novelty: 0.01962451
Score: 0.642
Data Source: STRINGDB
FAM169A
Tdark
Novelty: 1.40625
Score: 0.604
Data Source: STRINGDB
C6orf203
Tdark
Novelty: 0.625
Score: 0.563
Data Source: STRINGDB
TP53RK
Tbio
Family: Kinase
Novelty: 0.06549878
Score: 0.524
Data Source: STRINGDB
NKIRAS2
Tdark
Family: Enzyme
Novelty: 0.20963219
Score: 0.521
Data Source: STRINGDB
PLPP7
Tdark
Family: Enzyme
Novelty: 0.68965517
Score: 0.506
Data Source: STRINGDB
SDHB
Tbio
Family: Enzyme
Novelty: 0.0020679
Score: 0.493
Data Source: STRINGDB
Publication Statistics
PubMed Score  123.03

PubMed score by year
PubTator Score  70.92

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAASWSLLVTLRPLAQSPLRGRCVGCGAWAAALAPLATAPGKPFWKAYTVQTSESMTPTATSETYLKALA
1-70
VCHGPLDHYDFLIKAHELKDDEHQRRVIQCLQKLHEDLKGYNIEAEGLFSKLFSRSKPPRGLYVYGDVGT
70-140
GKTMVMDMFYAYVEMKRKKRVHFHGFMLDVHKRIHRLKQSLPKRKPGFMAKSYDPIAPIAEEISEEACLL
140-210
CFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKEYCNTVQLDSG
210-280
IDYRKRELPAAGKLYYLTSEADVEAVMDKLFDELAQKQNDLTRPRILKVQGRELRLNKACGTVADCTFEE
280-350
LCERPLGASDYLELSKNFDTIFLRNIPQFTLANRTQGRRFITLIDNFYDLKVRIICSASTPISSLFLHQH
350-420
HDSELEQSRILMDDLGLSQDSAEGLSMFTGEEEIFAFQRTISRLTEMQTEQYWNEGDRTKK
420-481
MAASWSLLVTLRPLAQSPLRGRCVGCGAWAAALAPLATAPGKPFWKAYTVQTSESMTPTATSETYLKALAVCHGPLDHYDFLIKAHELKDDEHQRRVIQCLQKLHEDLKGYNIEAEGLFSKLFSRSKPPRGLYVYGDVGTGKTMVMDMFYAYVEMKRKKRVHFHGFMLDVHKRIHRLKQSLPKRKPGFMAKSYDPIAPIAEEISEEACLLCFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKEYCNTVQLDSGIDYRKRELPAAGKLYYLTSEADVEAVMDKLFDELAQKQNDLTRPRILKVQGRELRLNKACGTVADCTFEELCERPLGASDYLELSKNFDTIFLRNIPQFTLANRTQGRRFITLIDNFYDLKVRIICSASTPISSLFLHQHHDSELEQSRILMDDLGLSQDSAEGLSMFTGEEEIFAFQRTISRLTEMQTEQYWNEGDRTKK