You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SFT2D1
Vesicle transport protein SFT2A

Protein Summary
Description
May be involved in fusion of retrograde transport vesicles derived from an endocytic compartment with the Golgi complex.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000361731
  • ENSP00000354590
  • ENSG00000198818

Symbol
  • C6orf83
  • pRGR1
  • C6orf83
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.76
gene perturbation
0.71
kinase perturbation
0.71
cell type or tissue
0.64
small molecule perturbation
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.33   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 12   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.33   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 12   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (37)
1 – 10 of 37
C4orf33
Tdark
Score: 0.696
Data Source: STRINGDB
PRR18
Tdark
Novelty: 1.8
Score: 0.686
Data Source: STRINGDB
ZFAND1
Tbio
Novelty: 0.76923077
Score: 0.679
Data Source: STRINGDB
CTDNEP1
Tbio
Family: Enzyme
Novelty: 0.11214953
Score: 0.661
Data Source: STRINGDB
C6orf118
Tdark
Novelty: 10
Score: 0.658
Data Source: STRINGDB
GOLT1A
Tdark
Novelty: 0.5
Score: 0.617
Data Source: STRINGDB
STX5
Tbio
Novelty: 0.01314285
Score: 0.596
Data Source: STRINGDB
TMEM60
Tdark
Novelty: 0.28429181
Score: 0.583
Data Source: STRINGDB
LHFPL6
Tdark
Novelty: 0.24842361
Score: 0.573
Data Source: STRINGDB
KIF25
Tbio
Novelty: 0.16780617
Score: 0.568
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.33

PubMed score by year
PubTator Score  0.25

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGGIKLFAVFYTL
1-70
GNLAALASTCFLMGPVKQLKKMFEATRLLATIVMLLCFIFTLCAALWWHKKGLAVLFCILQFLSMTWYSL
70-140
SYIPYARDAVIKCCSSLLS
140-159
MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGGIKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFEATRLLATIVMLLCFIFTLCAALWWHKKGLAVLFCILQFLSMTWYSLSYIPYARDAVIKCCSSLLS