You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PDCD6IP
Programmed cell death 6-interacting protein

Protein Summary
Description
Multifunctional protein involved in endocytosis, multivesicular body biogenesis, membrane repair, cytokinesis, apoptosis and maintenance of tight junction integrity. Class E VPS protein involved in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome. Binds to the phospholipid lysobisphosphatidic acid (LBPA) which is abundant in MVBs internal membranes. The MVB pathway requires the sequential function of ESCRT-O, -I,-II and -III complexes (PubMed:14739459). The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis (PubMed:17853893, PubMed:17556548). Adapter for a subset of ESCRT-III proteins, such as CHMP4, to function at distinct membranes. Required for completion of cytokinesis (PubMed:17853893, PubMed:17556548, PubMed:18641129). May play a role in ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000307296
  • ENSP00000307387
  • ENSG00000170248
  • ENST00000457054
  • ENSP00000411825

Symbol
  • AIP1
  • ALIX
  • KIAA1375
  • AIP1
  • ALIX
  • HP95
  • DRIP4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
kinase perturbation
0.93
hub protein
0.92
transcription factor perturbation
0.91
transcription factor binding site profile
0.9


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 35.24   (req: < 5)
Gene RIFs: 96   (req: <= 3)
Antibodies: 335   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 35.24   (req: >= 5)
Gene RIFs: 96   (req: > 3)
Antibodies: 335   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (18)
1 – 5 of 18
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Budding and maturation of HIV virion (R-HSA-162588)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Budding and maturation of HIV virion
Reactome
Disease
Reactome
HIV Infection
Reactome
HIV Life Cycle
Reactome
Infectious disease
Name
Explore in Pharos
Explore in Source
Budding and maturation of HIV virion
Disease
HIV Infection
HIV Life Cycle
Infectious disease
Protein-Protein Interactions (125)
1 – 10 of 125
CHMP4B
Tbio
Novelty: 0.02197696
Score: 0.995
Data Source: STRINGDB
CHMP4A
Tbio
Novelty: 0.01746823
Score: 0.992
Data Source: STRINGDB
TSG101
Tbio
Novelty: 0.00310287
Score: 0.992
Data Source: STRINGDB
CHMP4C
Tbio
Novelty: 0.1149268
Score: 0.99
Data Source: STRINGDB
VPS4B
Tbio
Novelty: 0.00983426
Score: 0.989
Data Source: STRINGDB
VPS4A
Tbio
Novelty: 0.01985299
Score: 0.979
Data Source: STRINGDB
VPS28
Tbio
Novelty: 0.04542177
Score: 0.979
Data Source: STRINGDB
CHMP6
Tbio
Novelty: 0.0478065
Score: 0.978
Data Source: STRINGDB
CHMP2A
Tbio
Novelty: 0.00337804
Score: 0.967
Data Source: STRINGDB
CHMP5
Tbio
Novelty: 0.03824259
Score: 0.953
Data Source: STRINGDB
Publication Statistics
PubMed Score  35.24

PubMed score by year
PubTator Score  162.72

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLR
1-70
YYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNL
70-140
DNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKD
140-210
AIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHA
210-280
AELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQK
280-350
FTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTK
350-420
SRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRA
420-490
EGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLD
490-560
EVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQ
560-630
VSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKT
630-700
ERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPS
700-770
ATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQS
770-840
PGQAPYPGPQQPSYPFPQPPQQSYYPQQ
840-868
MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPSATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQSYYPQQ