You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PIGO
GPI ethanolamine phosphate transferase 3

Protein Summary
Description
Ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers ethanolamine phosphate to the GPI third mannose which links the GPI-anchor to the C-terminus of the proteins by an amide bond. This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This protein is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI. At least three alternatively spliced transcripts encoding two distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000298004
  • ENSP00000298004
  • ENSG00000165282
  • ENST00000361778
  • ENSP00000354678
  • ENST00000378617
  • ENSP00000367880

Symbol
  • HPMRS2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.88
metabolite
0.73
transcription factor binding site profile
0.69
kinase perturbation
0.66
tissue sample
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.39   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 136   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.39   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 136   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Post-translational modification: synthesis of GPI-anchored proteins
Reactome
Post-translational protein modification
Reactome
Synthesis of glycosylphosphatidylinositol (GPI)
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Post-translational modification: synthesis of GPI-anchored proteins
Post-translational protein modification
Synthesis of glycosylphosphatidylinositol (GPI)
Protein-Protein Interactions (81)
1 – 10 of 81
POTEI
Tdark
Novelty: 0.30601093
p_int: 0.9997935
p_ni: 0.0002065
Score: 0.166
Data Source: BioPlex,STRINGDB
ATP2B2
Tbio
Family: Transporter
Novelty: 0.00724828
p_int: 0.995943998
p_ni: 0.004056
p_wrong: 2e-9
Score: 0.187
Data Source: BioPlex,STRINGDB
HTR3A
Tclin
Family: IC
Novelty: 0.00035394
p_int: 0.985723619
p_ni: 0.014276381
Data Source: BioPlex
PSCA
Tbio
Novelty: 0.00370639
p_int: 0.983850658
p_ni: 0.016149342
Data Source: BioPlex
NKAIN1
Tdark
Family: Enzyme
Novelty: 0.60115607
p_int: 0.979635389
p_ni: 0.020364611
Data Source: BioPlex
ATP2A3
Tbio
Family: Transporter
Novelty: 0.01101086
p_int: 0.965678583
p_ni: 0.034321417
Score: 0.205
Data Source: BioPlex,STRINGDB
UPK1A
Tbio
Novelty: 0.02382993
p_int: 0.953973913
p_ni: 0.046026087
Data Source: BioPlex
PTCHD3
Tbio
Novelty: 0.00118764
p_int: 0.94416343
p_ni: 0.05583657
Data Source: BioPlex
HTR3C
Tchem
Family: IC
Novelty: 0.1761544
p_int: 0.906010891
p_ni: 0.093989096
p_wrong: 1.3e-8
Data Source: BioPlex
ADGRG5
Tdark
Family: GPCR
Novelty: 0.38877844
p_int: 0.890400635
p_ni: 0.109599333
p_wrong: 3.2e-8
Data Source: BioPlex
Publication Statistics
PubMed Score  9.39

PubMed score by year
PubTator Score  5.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQKASVLLFLAWVCFLFYAGIALFTSGFLLTRLELTNHSSCQEPPGPGSLPWGSQGKPGACWMASRFSRV
1-70
VLVLIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRSQVDPPTTTMQRLKALTT
70-140
GSLPTFIDAGSNFASHAIVEDNLIKQLTSAGRRVVFMGDDTWKDLFPGAFSKAFFFPSFNVRDLDTVDNG
140-210
ILEHLYPTMDSGEWDVLIAHFLGVDHCGHKHGPHHPEMAKKLSQMDQVIQGLVERLENDTLLVVAGDHGM
210-280
TTNGDHGGDSELEVSAALFLYSPTAVFPSTPPEEPEVIPQVSLVPTLALLLGLPIPFGNIGEVMAELFSG
280-350
GEDSQPHSSALAQASALHLNAQQVSRFLHTYSAATQDLQAKELHQLQNLFSKASADYQWLLQSPKGAEAT
350-420
LPTVIAELQQFLRGARAMCIESWARFSLVRMAGGTALLAASCFICLLASQWAISPGFPFCPLLLTPVAWG
420-490
LVGAIAYAGLLGTIELKLDLVLLGAVAAVSSFLPFLWKAWAGWGSKRPLATLFPIPGPVLLLLLFRLAVF
490-560
FSDSFVVAEARATPFLLGSFILLLVVQLHWEGQLLPPKLLTMPRLGTSATTNPPRHNGAYALRLGIGLLL
560-630
CTRLAGLFHRCPEETPVCHSSPWLSPLASMVGGRAKNLWYGACVAALVALLAAVRLWLRRYGNLKSPEPP
630-700
MLFVRWGLPLMALGTAAYWALASGADEAPPRLRVLVSGASMVLPRAVAGLAASGLALLLWKPVTVLVKAG
700-770
AGAPRTRTVLTPFSGPPTSQADLDYVVPQIYRHMQEEFRGRLERTKSQGPLTVAAYQLGSVYSAAMVTAL
770-840
TLLAFPLLLLHAERISLVFLLLFLQSFLLLHLLAAGIPVTTPGPFTVPWQAVSAWALMATQTFYSTGHQP
840-910
VFPAIHWHAAFVGFPEGHGSCTWLPALLVGANTFASHLLFAVGCPLLLLWPFLCESQGLRKRQQPPGNEA
910-980
DARVRPEEEEEPLMEMRLRDAPQHFYAALLQLGLKYLFILGIQILACALAASILRRHLMVWKVFAPKFIF
980-1050
EAVGFIVSSVGLLLGIALVMRVDGAVSSWFRQLFLAQQR
1050-1089
MQKASVLLFLAWVCFLFYAGIALFTSGFLLTRLELTNHSSCQEPPGPGSLPWGSQGKPGACWMASRFSRVVLVLIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRSQVDPPTTTMQRLKALTTGSLPTFIDAGSNFASHAIVEDNLIKQLTSAGRRVVFMGDDTWKDLFPGAFSKAFFFPSFNVRDLDTVDNGILEHLYPTMDSGEWDVLIAHFLGVDHCGHKHGPHHPEMAKKLSQMDQVIQGLVERLENDTLLVVAGDHGMTTNGDHGGDSELEVSAALFLYSPTAVFPSTPPEEPEVIPQVSLVPTLALLLGLPIPFGNIGEVMAELFSGGEDSQPHSSALAQASALHLNAQQVSRFLHTYSAATQDLQAKELHQLQNLFSKASADYQWLLQSPKGAEATLPTVIAELQQFLRGARAMCIESWARFSLVRMAGGTALLAASCFICLLASQWAISPGFPFCPLLLTPVAWGLVGAIAYAGLLGTIELKLDLVLLGAVAAVSSFLPFLWKAWAGWGSKRPLATLFPIPGPVLLLLLFRLAVFFSDSFVVAEARATPFLLGSFILLLVVQLHWEGQLLPPKLLTMPRLGTSATTNPPRHNGAYALRLGIGLLLCTRLAGLFHRCPEETPVCHSSPWLSPLASMVGGRAKNLWYGACVAALVALLAAVRLWLRRYGNLKSPEPPMLFVRWGLPLMALGTAAYWALASGADEAPPRLRVLVSGASMVLPRAVAGLAASGLALLLWKPVTVLVKAGAGAPRTRTVLTPFSGPPTSQADLDYVVPQIYRHMQEEFRGRLERTKSQGPLTVAAYQLGSVYSAAMVTALTLLAFPLLLLHAERISLVFLLLFLQSFLLLHLLAAGIPVTTPGPFTVPWQAVSAWALMATQTFYSTGHQPVFPAIHWHAAFVGFPEGHGSCTWLPALLVGANTFASHLLFAVGCPLLLLWPFLCESQGLRKRQQPPGNEADARVRPEEEEEPLMEMRLRDAPQHFYAALLQLGLKYLFILGIQILACALAASILRRHLMVWKVFAPKFIFEAVGFIVSSVGLLLGIALVMRVDGAVSSWFRQLFLAQQR