You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SAP25
Histone deacetylase complex subunit SAP25

Protein Summary
Description
Involved in the transcriptional repression mediated by the mSIN3A but not the N-CoR corepressor complex.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000538735
  • ENSP00000442339
  • ENSG00000205307
  • ENST00000614631
  • ENSP00000481351
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.78
tissue sample
0.69
hub protein
0.58
cell line
0.55
transcription factor
0.47


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.72   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 4   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.72   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 4   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (8)
1 – 8 of 8
SIN3A
Tbio
Novelty: 0.01059111
Score: 0.892
Data Source: STRINGDB
SIN3B
Tbio
Novelty: 0.04173216
Score: 0.769
Data Source: STRINGDB
SAP30
Tbio
Family: Enzyme
Novelty: 0.05788749
Score: 0.674
Data Source: STRINGDB
SAP30L
Tbio
Family: Enzyme
Novelty: 0.21724952
Score: 0.583
Data Source: STRINGDB
SUDS3
Tbio
Family: Enzyme
Novelty: 0.02419541
Score: 0.57
Data Source: STRINGDB
TTLL12
Tbio
Family: Enzyme
Novelty: 0.19565217
Score: 0.567
Data Source: STRINGDB
RBBP7
Tbio
Novelty: 0.02883677
Score: 0.531
Data Source: STRINGDB
ARID4B
Tbio
Family: TF; Epigenetic
Novelty: 0.05116399
Score: 0.511
Data Source: STRINGDB
Publication Statistics
PubMed Score  2.72

PubMed score by year
PubTator Score  1.68

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTPLAPWDPKYEAKAGPRPVWGANCSSGASFSGRTLCHPSFWPLYEAASGRGLRPVAPATGHWNGQQAPP
1-70
DAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSLKLLPPPPIMSARVLPRPSPSRGPSTAWLSG
70-140
PELIALTGLLQMSQGEPRPSSSAVGPPDHTSDPPSPCGSPSSSQGADLSLPQTPDTHCP
140-199
MTPLAPWDPKYEAKAGPRPVWGANCSSGASFSGRTLCHPSFWPLYEAASGRGLRPVAPATGHWNGQQAPPDAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSLKLLPPPPIMSARVLPRPSPSRGPSTAWLSGPELIALTGLLQMSQGEPRPSSSAVGPPDHTSDPPSPCGSPSSSQGADLSLPQTPDTHCP