You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
EPS8L3
Epidermal growth factor receptor kinase substrate 8-like protein 3

Protein Summary
Description
This gene encodes a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown. Alternatively spliced transcript variants encoding different isoforms exist. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000361852
  • ENSP00000354551
  • ENSG00000198758
  • ENST00000361965
  • ENSP00000355255
  • ENST00000369805
  • ENSP00000358820

Symbol
  • EPS8R3
  • EPS8R3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.71
cell line
0.53
cell type or tissue
0.44
chemical
0.44
transcription factor
0.43


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.02   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 134   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.02   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 134   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (35)
1 – 10 of 35
STRIP1
Tbio
Novelty: 0.15362107
Score: 0.748
Data Source: STRINGDB
SLC45A4
Tdark
Family: Transporter
Novelty: 0.60606061
Score: 0.725
Data Source: STRINGDB
ZFYVE28
Tbio
Novelty: 1
Score: 0.716
Data Source: STRINGDB
ABI1
Tbio
Novelty: 0.00801126
Score: 0.671
Data Source: STRINGDB
USH1C
Tbio
Novelty: 0.00768448
Score: 0.661
Data Source: STRINGDB
SLC6A19
Tchem
Family: Transporter
Novelty: 0.01236925
Score: 0.661
Data Source: STRINGDB
REG4
Tbio
Novelty: 0.00818258
Score: 0.654
Data Source: STRINGDB
IGSF23
Tdark
Score: 0.633
Data Source: STRINGDB
SLC44A4
Tbio
Family: Transporter
Novelty: 0.01807462
Score: 0.585
Data Source: STRINGDB
AGR2
Tbio
Novelty: 0.00676781
Score: 0.585
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.02

PubMed score by year
PubTator Score  2.9

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSRPSSRAIYLHRKEYSQNLTSEPTLLQHRVEHLMTCKQGSQRVQGPEDALQKLFEMDAQGRVWSQDLIL
1-70
QVRDGWLQLLDIETKEELDSYRLDSIQAMNVALNTCSYNSILSITVQEPGLPGTSTLLFQCQEVGAERLK
70-140
TSLQKALEEELEQRPRLGGLQPGQDRWRGPAMERPLPMEQARYLEPGIPPEQPHQRTLEHSLPPSPRPLP
140-210
RHTSAREPSAFTLPPPRRSSSPEDPERDEEVLNHVLRDIELFMGKLEKAQAKTSRKKKFGKKNKDQGGLT
210-280
QAQYIDCFQKIKHSFNLLGRLATWLKETSAPELVHILFKSLNFILARCPEAGLAAQVISPLLTPKAINLL
280-350
QSCLSPPESNLWMGLGPAWTTSRADWTGDEPLPYQPTFSDDWQLPEPSSQAPLGYQDPVSLRRGSHRLGS
350-420
TSHFPQEKTHNHDPQPGDPNSRPSSPKPAQPALKMQVLYEFEARNPRELTVVQGEKLEVLDHSKRWWLVK
420-490
NEAGRSGYIPSNILEPLQPGTPGTQGQSPSRVPMLRLSSRPEEVTDWLQAENFSTATVRTLGSLTGSQLL
490-560
RIRPGELQMLCPQEAPRILSRLEAVRRMLGISP
560-593
MSRPSSRAIYLHRKEYSQNLTSEPTLLQHRVEHLMTCKQGSQRVQGPEDALQKLFEMDAQGRVWSQDLILQVRDGWLQLLDIETKEELDSYRLDSIQAMNVALNTCSYNSILSITVQEPGLPGTSTLLFQCQEVGAERLKTSLQKALEEELEQRPRLGGLQPGQDRWRGPAMERPLPMEQARYLEPGIPPEQPHQRTLEHSLPPSPRPLPRHTSAREPSAFTLPPPRRSSSPEDPERDEEVLNHVLRDIELFMGKLEKAQAKTSRKKKFGKKNKDQGGLTQAQYIDCFQKIKHSFNLLGRLATWLKETSAPELVHILFKSLNFILARCPEAGLAAQVISPLLTPKAINLLQSCLSPPESNLWMGLGPAWTTSRADWTGDEPLPYQPTFSDDWQLPEPSSQAPLGYQDPVSLRRGSHRLGSTSHFPQEKTHNHDPQPGDPNSRPSSPKPAQPALKMQVLYEFEARNPRELTVVQGEKLEVLDHSKRWWLVKNEAGRSGYIPSNILEPLQPGTPGTQGQSPSRVPMLRLSSRPEEVTDWLQAENFSTATVRTLGSLTGSQLLRIRPGELQMLCPQEAPRILSRLEAVRRMLGISP