You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TAS1R2
Taste receptor type 1 member 2

Protein Summary
Description
Putative taste receptor. TAS1R2/TAS1R3 recognizes diverse natural and synthetic sweeteners.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000375371
  • ENSP00000364520
  • ENSG00000179002

Symbol
  • GPR71
  • T1R2
  • TR2
  • TR2
  • T1R2
  • GPR71
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
tissue
0.71
tissue sample
0.71
cell type or tissue
0.56
cell line
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 109.59   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 185   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 109.59   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 185   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (8)
Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class C/3 (Metabotropic glutamate/pheromone receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class C/3 (Metabotropic glutamate/pheromone receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Protein-Protein Interactions (273)
1 – 10 of 273
GNAT3
Tbio
Novelty: 0.004945
Score: 0.99
Data Source: STRINGDB
TAS2R13
Tbio
Family: GPCR
Novelty: 0.49152154
Score: 0.971
Data Source: STRINGDB
TAS2R38
Tbio
Family: GPCR
Novelty: 0.00547147
Score: 0.971
Data Source: STRINGDB
TAS2R4
Tbio
Family: GPCR
Novelty: 0.04115092
Score: 0.968
Data Source: STRINGDB
TAS2R5
Tbio
Family: GPCR
Novelty: 0.13852935
Score: 0.967
Data Source: STRINGDB
TAS2R1
Tbio
Family: GPCR
Novelty: 0.10027518
Score: 0.964
Data Source: STRINGDB
TAS2R9
Tdark
Family: GPCR
Novelty: 0.61888389
Score: 0.964
Data Source: STRINGDB
TAS2R10
Tbio
Family: GPCR
Novelty: 0.12379073
Score: 0.961
Data Source: STRINGDB
TAS2R3
Tbio
Family: GPCR
Novelty: 0.21776992
Score: 0.959
Data Source: STRINGDB
PYY
Tbio
Novelty: 0.0007798
Score: 0.958
Data Source: STRINGDB
Publication Statistics
PubMed Score  109.59

PubMed score by year
PubTator Score  74.1

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MGPRAKTISSLFFLLWVLAEPAENSDFYLPGDYLLGGLFSLHANMKGIVHLNFLQVPMCKEYEVKVIGYN
1-70
LMQAMRFAVEEINNDSSLLPGVLLGYEIVDVCYISNNVQPVLYFLAHEDNLLPIQEDYSNYISRVVAVIG
70-140
PDNSESVMTVANFLSLFLLPQITYSAISDELRDKVRFPALLRTTPSADHHIEAMVQLMLHFRWNWIIVLV
140-210
SSDTYGRDNGQLLGERVARRDICIAFQETLPTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLT
210-280
LYHFFNEVLRQNFTGAVWIASESWAIDPVLHNLTELRHLGTFLGITIQSVPIPGFSEFREWGPQAGPPPL
280-350
SRTSQSYTCNQECDNCLNATLSFNTILRLSGERVVYSVYSAVYAVAHALHSLLGCDKSTCTKRVVYPWQL
350-420
LEEIWKVNFTLLDHQIFFDPQGDVALHLEIVQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTI
420-490
PMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPNNEWSYQSETSCFKRQLVFLE
490-560
WHEAPTIAVALLAALGFLSTLAILVIFWRHFQTPIVRSAGGPMCFLMLTLLLVAYMVVPVYVGPPKVSTC
560-630
LCRQALFPLCFTICISCIAVRSFQIVCAFKMASRFPRAYSYWVRYQGPYVSMAFITVLKMVIVVIGMLAT
630-700
GLSPTTRTDPDDPKITIVSCNPNYRNSLLFNTSLDLLLSVVGFSFAYMGKELPTNYNEAKFITLSMTFYF
700-770
TSSVSLCTFMSAYSGVLVTIVDLLVTVLNLLAISLGYFGPKCYMILFYPERNTPAYFNSMIQGYTMRRD
770-839
MGPRAKTISSLFFLLWVLAEPAENSDFYLPGDYLLGGLFSLHANMKGIVHLNFLQVPMCKEYEVKVIGYNLMQAMRFAVEEINNDSSLLPGVLLGYEIVDVCYISNNVQPVLYFLAHEDNLLPIQEDYSNYISRVVAVIGPDNSESVMTVANFLSLFLLPQITYSAISDELRDKVRFPALLRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETLPTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVWIASESWAIDPVLHNLTELRHLGTFLGITIQSVPIPGFSEFREWGPQAGPPPLSRTSQSYTCNQECDNCLNATLSFNTILRLSGERVVYSVYSAVYAVAHALHSLLGCDKSTCTKRVVYPWQLLEEIWKVNFTLLDHQIFFDPQGDVALHLEIVQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPNNEWSYQSETSCFKRQLVFLEWHEAPTIAVALLAALGFLSTLAILVIFWRHFQTPIVRSAGGPMCFLMLTLLLVAYMVVPVYVGPPKVSTCLCRQALFPLCFTICISCIAVRSFQIVCAFKMASRFPRAYSYWVRYQGPYVSMAFITVLKMVIVVIGMLATGLSPTTRTDPDDPKITIVSCNPNYRNSLLFNTSLDLLLSVVGFSFAYMGKELPTNYNEAKFITLSMTFYFTSSVSLCTFMSAYSGVLVTIVDLLVTVLNLLAISLGYFGPKCYMILFYPERNTPAYFNSMIQGYTMRRD